SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6CJN0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6CJN0
Domain Number 1 Region: 4-277
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 6.77e-59
Family Lambda integrase-like, catalytic core 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6CJN0
Sequence length 284
Comment (tr|F6CJN0|F6CJN0_DESK7) Integrase family protein {ECO:0000313|EMBL:AEG15149.1} KW=Complete proteome; Reference proteome OX=760568 OS=Desulfotomaculum kuznetsovii (strain DSM 6115 / VKM B-1805 / 17). GN=Desku_1569 OC=Desulfotomaculum.
Sequence
MDILTSFKNSLLARGLSPGTAEIYAGHLRRFFAWVEGTYGEPDPAAVTPLDVADYRRFLQ
NRNRKPATVNNALDAIGSFFAWAKEAGIVQSDPTEGVKRLPEQKPAPKWLSRRELGALVR
AVQKYGSRRDQALVTLLLHTGLRVSEAVSLRVQDVVIRERSGHVAVRQGKGGKYREVPLN
ATARRTLGEYLATLSGEWLFPGRSGGPMTRRTAEKTLAKYARLAGVEATPHRLRHTFCKM
LVDAGESLDRVAVLAGHENMNTTARYTRPGRADLEAAVEKIAWE
Download sequence
Identical sequences F6CJN0
gi|333979005|ref|YP_004516950.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]