SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6CL24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6CL24
Domain Number 1 Region: 109-375
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 1.4e-65
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6CL24
Sequence length 377
Comment (tr|F6CL24|F6CL24_DESK7) Methyl-accepting chemotaxis sensory transducer {ECO:0000313|EMBL:AEG15389.1} KW=Complete proteome; Reference proteome OX=760568 OS=Desulfotomaculum kuznetsovii (strain DSM 6115 / VKM B-1805 / 17). GN=Desku_1825 OC=Desulfotomaculum.
Sequence
MTVGKLRRHLTLMTSVLALLAVSVTLLAGWLTHGNGPATLAGAAAGVLLAGALAALSCSS
LQATVNMVIDKTDKAIAGDLTERIEERNFGWGEINRLVTNVRKVLKGVHKWFGLVRDYSE
QLTTSTAQIISGTEQISTGSQEQAGQVQKLLQGIEDLARSARQSAEKARETAAIARETDL
TARKGGEAVDRVISGMNLIHEKIRTLDESSARIGQFVQLIEDIAAQTNLLALNAAIEAAR
AGEHGRGFAVVAQEVRELAENSARSTREITQLVAGIQGATGESVAAVQQGLQITGEVQEA
FRNIVSQIGRTVESIEELASAAQKQAASTEQMVGGVEAIAAVAEQAAASCQETAAITSEL
STLAEKLKSVAEIWKFS
Download sequence
Identical sequences F6CL24
gi|333979245|ref|YP_004517190.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]