SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6CM98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6CM98
Domain Number 1 Region: 1-416
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 2.49e-155
Family Aconitase iron-sulfur domain 0.0000000888
Further Details:      
 
Domain Number 2 Region: 437-639
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 7.46e-60
Family LeuD-like 0.0000797
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6CM98
Sequence length 640
Comment (tr|F6CM98|F6CM98_DESK7) Aconitate hydratase {ECO:0000313|EMBL:AEG16614.1} KW=Complete proteome; Reference proteome OX=760568 OS=Desulfotomaculum kuznetsovii (strain DSM 6115 / VKM B-1805 / 17). GN=Desku_3120 OC=Desulfotomaculum.
Sequence
MGYNLTQKILLNHLVSGTMQPGREIAIRIDQTLTQDATGTMAYLQFEAMGIPRVKTELSV
SYVDHNTLQTGFENADDHRFLQSTAAKYGAYFSRAGNGICHQVHLERFGVPGKTLLGSDS
HTPTAGGLGMLAIGVGGLDVAVAMGGGPFHMIMPGVVNIRLHGRLAPWATAKDVILEVLR
RLTVKGGVGKILEYGGEGVKSLTVPERATITNMGAETGATTSIFPSDEVTRAFLRAQGRE
EVWVELGPDPDAAYDEVLDIDLSTLEPLVACPHSPDNVKPVREVGPLAVDQVVIGSCTNS
SYLDLMKVAAILKGKVVHPRVSLVIAPGSRQVLTMLAQNGALADLVAAGARILECACGPC
IGMGQAPPSGGVSVRTINRNFKGRSGTADARVYLASPETAAATALTGRLTDPRELGDPPV
IALPERFHVDDRMIIPPADNPDNVEIVRGPNIKPLPVAEPLPRSIEGRVLLKVGDNITTD
HIMPAGARVLPLRSNIPAMAEYVFAAVDPSFPRRAREAGGGIIVGGENYGQGSSREHAAL
VPMYLGVKAVLAKSFARIHRDNLINFGILPLTFIEPADYDRLEQDDVLQIDQLHRALQEG
AELEVKNVTRNITFKVRAQLTPRQVEIILAGGLLNHTRRG
Download sequence
Identical sequences F6CM98
gi|333980470|ref|YP_004518415.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]