SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6CP76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6CP76
Domain Number 1 Region: 25-246
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.85e-38
Family PP-loop ATPase 0.01
Further Details:      
 
Weak hits

Sequence:  F6CP76
Domain Number - Region: 263-291
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0575
Family Recombination protein RecR 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6CP76
Sequence length 309
Comment (tr|F6CP76|F6CP76_DESK7) PP-loop domain protein {ECO:0000313|EMBL:AEG14013.1} KW=Complete proteome; Reference proteome OX=760568 OS=Desulfotomaculum kuznetsovii (strain DSM 6115 / VKM B-1805 / 17). GN=Desku_0385 OC=Desulfotomaculum.
Sequence
MRRCVKCKGESVINLKSTNAAFCQEHFIEYFLRQVARAIKKYKMLAEGQQVLVAVSGGKD
SMALWDALLSLGYRADGLHVDLGIGEYSEGSRLICERFAANRGARLYVLSLMDTYGSNMQ
EIVRRTRRVSCSVCGTVKRYLMNLVVQQKGYRVVATGHNLDDETAALLGNLFGWQEGYLA
RQYPHLPSTHARLPARVKPLVRLGEMETELYCRLKGIEFLADDCPLARGATSLAYKELIN
SLEEKMPGTKQRFLFGFWDRGRRSFIDTPVELKGCSLCGQPTTADTCLFCRLMQKAGIDP
LTQPQVQEM
Download sequence
Identical sequences F6CP76
gi|333977869|ref|YP_004515814.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]