SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6CSE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6CSE1
Domain Number 1 Region: 3-193
Classification Level Classification E-value
Superfamily SIS domain 3.34e-37
Family mono-SIS domain 0.00000868
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6CSE1
Sequence length 197
Comment (tr|F6CSE1|F6CSE1_MARPP) Phosphoheptose isomerase {ECO:0000313|EMBL:AEF54995.1} KW=Complete proteome; Reference proteome OX=491952 OS=Marinomonas posidonica (strain CECT 7376 / NCIMB 14433 / IVIA-Po-181). GN=Mar181_1957 OC=Oceanospirillaceae; Marinomonas.
Sequence
MDFQEAIYTQFAQSFEAQQQALESLPPYIEHAGKVIFSSIASGGKIICIGNSTGSHLAQY
FSTLMLDKMDRERPGLPAINLSGEGSSILAITHNDSYHDVFSKQITALGNPNDILFVIAN
RGNTSPIIQAIQAAHERKMSVVALTSPEAKNISSLTSQDDTEIKVNLLGTARVHECQITV
IHTLVDLLERQLFGYED
Download sequence
Identical sequences F6CSE1
WP_013796470.1.19944 gi|333908328|ref|YP_004481914.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]