SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6CUA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6CUA2
Domain Number 1 Region: 113-274
Classification Level Classification E-value
Superfamily SIS domain 1.25e-25
Family mono-SIS domain 0.0038
Further Details:      
 
Domain Number 2 Region: 9-85
Classification Level Classification E-value
Superfamily Homeodomain-like 2.33e-18
Family RpiR-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6CUA2
Sequence length 288
Comment (tr|F6CUA2|F6CUA2_MARPP) Transcriptional regulator, RpiR family {ECO:0000313|EMBL:AEF55221.1} KW=Complete proteome; Reference proteome OX=491952 OS=Marinomonas posidonica (strain CECT 7376 / NCIMB 14433 / IVIA-Po-181). GN=Mar181_2183 OC=Oceanospirillaceae; Marinomonas.
Sequence
MSAPNTLEQLQQTISRNYEGLSKRLQQVARFLLEHPNTVALETVASLAEQCGVPPSTLVR
FAAAFEYNGFSEMQNLFRQSLVEQTSISNYSERVKMNQNATGADIHADQILSEFSQRNAF
SMSHMPHQFSPEMLSSAVDLLENAENIYLIGLRRAFPISSYFAYSLRHLNKTTHLIDGGG
GMLVEQASNIRKDDVIIATTFSPYAQETVTVSEYAYAAGAKVIAITDSKISPLAGMSDVC
FDIKEAEVLGFRSLTSSMTLAQTLLVSLAYRLNADGQMGDTKQIAWNH
Download sequence
Identical sequences F6CUA2
gi|333908554|ref|YP_004482140.1| WP_013796696.1.19944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]