SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6CX53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6CX53
Domain Number 1 Region: 17-87
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000159
Family RpiR-like 0.043
Further Details:      
 
Domain Number 2 Region: 104-266
Classification Level Classification E-value
Superfamily SIS domain 0.000000337
Family mono-SIS domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6CX53
Sequence length 289
Comment (tr|F6CX53|F6CX53_MARPP) Transcriptional regulator, RpiR family {ECO:0000313|EMBL:AEF53307.1} KW=Complete proteome; Reference proteome OX=491952 OS=Marinomonas posidonica (strain CECT 7376 / NCIMB 14433 / IVIA-Po-181). GN=Mar181_0240 OC=Oceanospirillaceae; Marinomonas.
Sequence
MKNTFSSKPEHIATTTSQRIQELIPLVSKSEARVAQFILLNLDHISYETGASIAEKAAVS
QITVSRFLKRAGYQGISALKEELQKELIPIEANESQRLAPDSFYKDNLKQELKSMVRLYE
QFETENWESLVSCVSAATRVYVTGFQSIRGTAEDFTRRLSLARDRVQYLSPHDGMLGEWL
EDSSRSRKGYDTLIILDVVPYASEVRKLCEVAVEKGIQIVIISDEFCHWASEYDAHIVYS
KSKSGLFLESTWGLVLTTNMLVDAVSRRDVNSDTRIKRWQEMAKRLDLF
Download sequence
Identical sequences F6CX53
gi|333906640|ref|YP_004480226.1| WP_013794784.1.19944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]