SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6CXQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6CXQ5
Domain Number 1 Region: 4-546
Classification Level Classification E-value
Superfamily SIS domain 7.79e-207
Family Phosphoglucose isomerase, PGI 0.0000000000849
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6CXQ5
Sequence length 548
Comment (tr|F6CXQ5|F6CXQ5_MARPP) Phosphohexose isomerase {ECO:0000256|HAMAP-Rule:MF_00473} KW=Complete proteome; Reference proteome OX=491952 OS=Marinomonas posidonica (strain CECT 7376 / NCIMB 14433 / IVIA-Po-181). GN=Mar181_0302 OC=Oceanospirillaceae; Marinomonas.
Sequence
MRSPTEFSAWKKLAEHQQEMISVDMTSLFQADPKRADKYQAQAAGWTLDYAKNRANDTTL
SLLTELANEAGMKNAIDGMFSGAHINNTEDRSVLHVALRASQAQDTLMVDGVNVLAEVRA
TLKQMEQFVAQLHTGEWQGYTGKAITDVVSIGIGGSYLGPKVVAEALTPYKKDSIKVHFV
ANIDGSDITGKLKQLNPETTLFVISSKTFGTLETLSNANAARDWFLSNGGSQDNVSKHFA
AVSSNVKKAVDFGMAKENIFPMWDWVGGRYSLWSAIGLPVAIAVGMDNFYELLDGAHQMD
EHFRTAPLEENLPVIMGVLGVWYINFHNAQTHALIPYDHYLRAMPAHIQQLDMESNGKAN
LLNGDAVETDTGPIIWGGAGTNGQHAYHQLLHQGTRLVPVDFIAPLTSHNPIAEHHTHLF
ANCLSQSQALMVGKTLEQAQQELKDAGATDEQVAKIAPHKVIKGNRPSNTLLTDKMTPAS
VGALIALYEHRTFVQGTIWGINSFDQWGVELGKVLGTDIYNRLVSNSDNSALDASTQALI
KAFKKAQH
Download sequence
Identical sequences F6CXQ5
WP_013794845.1.19944 gi|333906701|ref|YP_004480287.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]