SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6D770 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6D770
Domain Number 1 Region: 5-103
Classification Level Classification E-value
Superfamily GlnB-like 0.00000000149
Family Prokaryotic signal transducing protein 0.018
Further Details:      
 
Weak hits

Sequence:  F6D770
Domain Number - Region: 112-156
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00133
Family Putative zinc binding domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6D770
Sequence length 168
Comment (tr|F6D770|F6D770_METPW) Uncharacterized protein {ECO:0000313|EMBL:AEG19029.1} KW=Complete proteome; Reference proteome OX=868131 OS=Methanobacterium paludis (strain DSM 25820 / JCM 18151 / SWAN1). GN=MSWAN_2020 OC=Methanobacteriaceae; Methanobacterium.
Sequence
MKIHLQVFVETENLGKAVNALTDAGITGFYILEYRGISPQDWKGFTINEDPKSAIGLIKD
YSTEAVLISSIVDEKKVDAIVELLREALKDERYTVLEVPIRRIIVNYAYQEKPEKKPKAW
IIENEVPCFYCGEKAIQRIQIDRKTAKVWCTNCGAARYYLLKGEKPEG
Download sequence
Identical sequences F6D770
WP_013826528.1.26247 gi|333988223|ref|YP_004520830.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]