SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6DQT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6DQT1
Domain Number 1 Region: 57-146
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 1.7e-24
Family Ribosomal protein L9 C-domain 0.00023
Further Details:      
 
Domain Number 2 Region: 1-57
Classification Level Classification E-value
Superfamily L9 N-domain-like 5.23e-17
Family Ribosomal protein L9 N-domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6DQT1
Sequence length 149
Comment (tr|F6DQT1|F6DQT1_DESRL) 50S ribosomal protein L9 {ECO:0000256|HAMAP-Rule:MF_00503} KW=Complete proteome; Reference proteome OX=696281 OS=DL). GN=Desru_3878 OC=Desulfotomaculum.
Sequence
MQVVLLQDVAKLGKKGDIANVAEGYARNFLFPRNLASPASEGKLKELSTQKQNQAAKKQK
QEEEAKALAAQISNLTVKLQAKVGEAGRLFGAVSSKDIADGLKTQHGCIVDKKKIVLKEP
IKTLGTHKITIKIHPVAQAEITVVITAIE
Download sequence
Identical sequences F6DQT1
gi|334342384|ref|YP_004547364.1| WP_013843823.1.34695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]