SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6DVG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6DVG6
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily CheY-like 3.84e-31
Family CheY-related 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6DVG6
Sequence length 252
Comment (tr|F6DVG6|F6DVG6_DESRL) Response regulator receiver {ECO:0000313|EMBL:AEG61426.1} KW=Complete proteome; Reference proteome OX=696281 OS=DL). GN=Desru_3220 OC=Desulfotomaculum.
Sequence
MLTVFIAEDDSSMRHVLKRTLEQIPGTKVLGEAGDGVTALKMIEKLRPRVVFIDIDLPEK
NGVDLAREICDIDPQILLIFATAYDDYTHEAFEVYAFDYLVKPFKLDRVKKTLERINQMD
LQRASAANYFHPPVAGEITPPRLVLRQNEKLLFLDTQEVILITRENRKTILHTTKQKLET
TETLNDIERRLTGNSFFRSHRGYIVNLSLIKEIYPWGKKGYQITFSGTKETALLTNEKFK
ELEKRLLYPETN
Download sequence
Identical sequences F6DVG6
gi|334341732|ref|YP_004546712.1| WP_013843172.1.34695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]