SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6DVM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6DVM9
Domain Number 1 Region: 3-281
Classification Level Classification E-value
Superfamily Folate-binding domain 7.22e-107
Family Aminomethyltransferase folate-binding domain 0.000000239
Further Details:      
 
Domain Number 2 Region: 273-362
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 6.87e-25
Family Aminomethyltransferase beta-barrel domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6DVM9
Sequence length 364
Comment (tr|F6DVM9|F6DVM9_DESRL) Glycine cleavage system T protein {ECO:0000256|HAMAP-Rule:MF_00259} KW=Complete proteome; Reference proteome OX=696281 OS=DL). GN=Desru_3283 OC=Desulfotomaculum.
Sequence
MADMKVTPLYNVHQRAGAKMVEFGGWLMPIQYEGILKEHQAVRTAAGLFDVSHMGEIEIT
GQEAASFIQRMITNDLTRLSPGGALYTPMCHPGGGTVDDLLVYRLEDHRYLLVVNASNVA
KDYQWLKDHAPEGVKVTDVSESTVQLALQGPLALKILQKLTSVNLSEIKYFYFVHGPVEG
VPCLISRTGYTGEDGFELYFAAEQAEKVWQAILDAGVEEGVKPVGLGARDTLRFEACLAL
YGHELSDSISPLMAGLGWTVKFNKGEFVGRENLLKEKEAGISHKLVGLEMLDRGIPRQGY
PVNREGREVGWITSGTFAPTLGKNLGLAYVLAQWAEIGSELDVVVRGKPLKARVVPKPFY
KREV
Download sequence
Identical sequences F6DVM9
gi|334341795|ref|YP_004546775.1| WP_013843235.1.34695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]