SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6FR70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6FR70
Domain Number 1 Region: 6-296
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 1.19e-70
Family ATP synthase (F1-ATPase), gamma subunit 0.0000639
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6FR70
Sequence length 299
Comment (tr|F6FR70|F6FR70_ISOV2) F-ATPase gamma subunit {ECO:0000256|HAMAP-Rule:MF_00815} KW=Complete proteome; Reference proteome OX=743718 OS=Isoptericola variabilis (strain 225). GN=Isova_2301 OC=Isoptericola.
Sequence
MAGGSQRVYKQRIKSTQSLKKMFRAQELIAASRIGKARARTAAATPYERAITRAVSAVAT
HSSTNHPLTSERDDTNRVAVLVIGADRGQAGAYSASLVRETEKLVAQLRAEGKEVSLYAT
GRRAIAFYRYRKRELAAEWSYGSENPQVDVATEVADTMLGAFLAPAEEGGVAELHVVYTQ
FVNMVTQRPRVVRMLPLEVVEGVAVPGEHQALPLYDFEPSPEVVLDALLPRYVRSRIFAF
MLDAAASELAARQRAMHTATDNAEDLIRTYTRLANQARQADITQEISEIVSGADALAAS
Download sequence
Identical sequences F6FR70
WP_013839411.1.6766 gi|334337762|ref|YP_004542914.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]