SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6FWX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6FWX8
Domain Number 1 Region: 16-211
Classification Level Classification E-value
Superfamily Formyltransferase 2.75e-57
Family Formyltransferase 0.0000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6FWX8
Sequence length 214
Comment (tr|F6FWX8|F6FWX8_ISOV2) GAR transformylase {ECO:0000256|HAMAP-Rule:MF_01930} KW=Complete proteome; Reference proteome OX=743718 OS=Isoptericola variabilis (strain 225). GN=Isova_0764 OC=Isoptericola.
Sequence
MQTPSGHPVESTTQARLVVLASGGGSNLAALLAAHDDPAYGARVVGVVSDKPEAGALRLA
RDAGVASVVVAPADFEDRAAWNVGMAEAVAVFRPDYVVLAGFMRILAPSFVDRFAGRIVN
THPALLPSFPGAHGVRDALAYGVKVTGCTVHVVDTGVDTGPIIAQAAVPVVDGDDEASLH
ERIKVAERALLVETVGRVAREGLRVDGRRAVVGR
Download sequence
Identical sequences F6FWX8
gi|334336292|ref|YP_004541444.1| WP_013837942.1.6766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]