SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6IMA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6IMA8
Domain Number 1 Region: 23-115
Classification Level Classification E-value
Superfamily YccV-like 6.15e-34
Family YccV-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6IMA8
Sequence length 126
Comment (tr|F6IMA8|F6IMA8_9SPHN) Hemimethylated DNA-binding region protein {ECO:0000313|EMBL:CCA92560.1} KW=Complete proteome; Reference proteome OX=702113 OS=Novosphingobium sp. PP1Y. GN=PP1Y_AT16882 OC=Sphingomonadaceae; Novosphingobium.
Sequence
MNRASFFSPQAGRVIDAPFQTRARFAIGDVVRHKQHDFRGVIFDIDPVFANSEEWYQSIP
LELRPSREQPYYHLLAENEDSSYVAYVSQQNLLEDAEGGPVDHPSVSEIFEEFRNGRYQL
RRGLAH
Download sequence
Identical sequences F6IMA8
WP_013832924.1.5499 gi|334141172|ref|YP_004534378.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]