SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6NPQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6NPQ3
Domain Number 1 Region: 716-864
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.57e-38
Family Regulator of G-protein signaling, RGS 0.0000822
Further Details:      
 
Domain Number 2 Region: 1047-1147
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.56e-31
Family Ras-binding domain, RBD 0.00097
Further Details:      
 
Domain Number 3 Region: 239-379
Classification Level Classification E-value
Superfamily PH domain-like 1.65e-22
Family Phosphotyrosine-binding domain (PTB) 0.014
Further Details:      
 
Domain Number 4 Region: 16-98
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-20
Family PDZ domain 0.0075
Further Details:      
 
Domain Number 5 Region: 993-1061
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000093
Family Ras-binding domain, RBD 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6NPQ3
Sequence length 1186
Comment (tr|F6NPQ3|F6NPQ3_DANRE) Regulator of G protein-signaling 12b {ECO:0000313|Ensembl:ENSDARP00000092310} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=rgs12 OC=Cyprinidae; Danio.
Sequence
MFRQSEQGRRRVNAQPSARIRGVEVARGRTGYGFTLSGQSPCVLNCILKGSPADYVGLRS
GDQILSVNDINVSKASHEDVVKLIGRCTGVLHLVIAEGSHKNGHVDSCSSDEELEFHDHK
SHWLRPKMDSKTLGINRAERVVAEMQSGGIFNMIFENSSHSSSSSERAVACASASKPRAV
SEPEFPYVSVNTQKSDPNLLTEEEMAKVLNDDSVFVDMFEPQDEFALLQTADSAGILNVG
MIVGYLGSIELASTSANLESDSLQAIRGCMRRLRAEQKVHSLVLLKVMHDCVQLCNDRGA
VLATYPAEKLAFSAVCPDDRRFFGLVTMQATNDHRMYRHGEEEQGLRTSCHVFIVDPELC
HHKIHQGIARRFGFDCTPDPDTGGCLEFPPTSQPLLQFVSVLYRDMGESIEGMRARAFLD
GDLDAQQNNSTSSNSDSGIGNFLPEEKNNRVLLVDLGANPSRHVPTGPWENPMGSFCQGA
IGGLPPPPPPPPISHRNGFRHEQFVDHPQPHPHSHGDPPLLSGRHLNSSSRLDVSGLPSR
SHYSAHGKKAAGASGQRWLPVHVLRDWRQGHSSDQESYAESTDGWSSANCSTLPPPMSKI
PADRYRAAGEIASQPHRLHAQKDEWAKKLFGEKNLREHSQQSNNVRRAKDSEKKGGRFKG
ITMGFPQRSSGRRSFGRSKRLSMARSLDDLESAAVSDGELNSVDLKGCGSDNSLNSNASL
PSVQCHRRHTERRVASWAVCFERLLQDPVGVRYFSEFLKKEFSEENILFWQACEYFSHVP
ETDKKQLSQRAREIYNSFLSSKATTPVNIDSQAQLADDILNAPRPDMFKEQQLQIFNLMK
FDSYTRFLKSYLYQECMLAEVEGRPLPDPYQVPSSPTSKHSTGSDRSNLSTPKKVQDDKK
SKSGRSLNEDSRDEHGDKKKSIFFSWSRNRSFGKGSKKRDLADYSFTGSNGRRESQGSLS
SGASLELATSGSGKNEGEVSRNSMSLSERAVRHCNINLPDGSCCSVPIRPGVSIREVLLG
LCEKLGINLAAVDLFLVGGEKPLVLDQDCMTLCSRDLRLEKRTLFRLDLVPINRSVGLKA
KPTKPVTEVLRPVVAKYGLNLGDLVATISGEKEPLDLGLPISNLDGLRVVLEAGDHVSGK
GKRNKQKLVSSKSHGPPLSTRSQSATNSSSSYPKHRATELTTSGVC
Download sequence
Identical sequences F6NPQ3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]