SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6PGK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6PGK5
Domain Number 1 Region: 240-309
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000379
Family HLH, helix-loop-helix DNA-binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  F6PGK5
Domain Number - Region: 299-388
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 0.0403
Family NADH oxidase/flavin reductase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6PGK5
Sequence length 487
Comment (tr|F6PGK5|F6PGK5_CALJA) Transcription factor EB {ECO:0000313|Ensembl:ENSCJAP00000007642} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=TFEB OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MTASSGWEPVPAATMASRIGLRMQLMREQAQQEEQRERMQQQAVMHYMQQQQQQQLGGPP
TPAINTPVHFQSPPPVPGEVLKVQSYLENPTSYHLQQSQHQKVREYLSETYGNKFAAHIS
PAQGSPKPPPAASPGVRAGHVLSSSAGNSAPNSPMAMLHIGSNPEREFDDVIDNIMRLDD
VLGYINPEMQMPNTLPLSSSHLNVYSSDPQVTASLVGVTSSSCPADLTQKRELTDAESRA
LAKERQKKDNHNLIERRRRFNINDRIKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQ
KDLQKSRELENHSRRLEMTNKQLWLRIQELEMQARVHGLPTTSPSGMNMAELAQQVVKQE
LPSEEGPGEALMLGAEVPDPEPLPALPPQAPLPLPTQPPSPFHHLDFSHSLSFGGREDEG
PPGYPEPLAPEHGSPFPGLSKKDLDLMLLDDSLLPLASDPLLSTMSPEASKASSRRSSFS
MEEGDVL
Download sequence
Identical sequences F6PGK5
ENSCJAP00000007642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]