SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6PKG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6PKG7
Domain Number 1 Region: 641-942
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.42e-89
Family Protein kinases, catalytic subunit 0.0000000578
Further Details:      
 
Domain Number 2 Region: 210-287
Classification Level Classification E-value
Superfamily HR1 repeat 3.4e-24
Family HR1 repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 133-207
Classification Level Classification E-value
Superfamily HR1 repeat 1.7e-23
Family HR1 repeat 0.0000914
Further Details:      
 
Domain Number 4 Region: 27-106
Classification Level Classification E-value
Superfamily HR1 repeat 1.44e-20
Family HR1 repeat 0.00031
Further Details:      
 
Domain Number 5 Region: 379-478
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000386
Family PLC-like (P variant) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6PKG7
Sequence length 958
Comment (tr|F6PKG7|F6PKG7_MONDO) Protein kinase N2 {ECO:0000313|Ensembl:ENSMODP00000015553} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=PKN2 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MASNTERGEILLTELQGDARSLLLPENVSTGQKLDFSDTMVQQKLDDIKDRIKREIRKEL
KIKEGAENLRKVTTDKKNLAYVDNILKKSNKKLEELHHKLQELNAHIVVTDPEDLTDCPR
TPDTPNSDPRCATSNKLMALKKQLDIELKVKQGAENMIQMYSNGSSKDRKLLATAQQLLQ
DSKTKIEVIRMQILQAVQTNELAFDNAKPVISPLELRMEELRHHFRIEFAVAEGAKNVMK
LLGSGKVADRKALSEAQARFNESSQKLDLLKYSLEQRLSELPKNHPKSSIIIEELSLVGS
PTLSPRQSVISTQNQYSTLSKPAALTGTLEVRLMGCQDILENVPGRSKATSVTLPGWSPS
ETRSSFMSRTSKSKSGSSRNLLKTDDLSNDICAVLKLDNTVVGQTSWKPISNQSWDQKFT
LELDRSRELEISVYWRDWRSLCAVKFLRLEDFLDNQRHGMCLYLEPQGTLFAEVTFFNPV
IERRPKLQRQKKIFSKQQGKTFLRAPQMNINIATWGRLVRRAIPTVNHSGTFSPQAPGPT
TVPVVDVRIPELSPPASDSTVTKLDFELEPEAPPAPPRTSSFGEIHEPSELRVLDVSGQD
SETTFNFENDRNSIVPKNQPEYEPPVLQSSLEYGGVQEPEERRSPQRFQFSLQDFRCCAV
LGRGHFGKVLLAEYKNTNEMFAIKALKKGDIVARDEVDSLMCEKRIFETVNSVRHPFLVN
LFACFQTKEHVCFVMEYAAGGDLMMHIHTDVFSEPRAVFYAACVVLGLQYLHEHKIVYRD
LKLDNLLLDTEGFVKIADFGLCKEGMGFGDRTSTFCGTPEFLAPEVLTETSYTRAVDWWG
LGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRNPERRLGA
GEKDAEDVKKHPFFRLIDWNALLAKKVKPPFVPTIRGREDRIPLSCACLKWKEEQLVI
Download sequence
Identical sequences F6PKG7
ENSMODP00000015553 ENSMODP00000015553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]