SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6PMU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6PMU7
Domain Number 1 Region: 1-201
Classification Level Classification E-value
Superfamily Formyltransferase 2.75e-51
Family Formyltransferase 0.00000000255
Further Details:      
 
Domain Number 2 Region: 205-306
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.73e-26
Family Post formyltransferase domain 0.00000106
Further Details:      
 
Domain Number 3 Region: 414-492
Classification Level Classification E-value
Superfamily ALDH-like 0.0000000000000071
Family ALDH-like 0.00061
Further Details:      
 
Domain Number 4 Region: 323-406
Classification Level Classification E-value
Superfamily ACP-like 0.00000331
Family Acyl-carrier protein (ACP) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6PMU7
Sequence length 505
Comment (tr|F6PMU7|F6PMU7_CALJA) Aldehyde dehydrogenase 1 family member L1 {ECO:0000313|Ensembl:ENSCJAP00000012834} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=ALDH1L1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MKIAVIGQSLFGQEVYCHLRKEGHEVVGVFTVPDKDGKADPLGLQAEKDGVPVFKFARWR
AKGQVLPDVVAKYQALGAELNVLPFCSQFIPMEIINAPRHGSIIYHPSLLPRHRGASAIN
WTLIHGDKKGGFSIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAV
RLIAEGKAPRLPQPEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEACEQ
KLTFFNSTLNTSGLVPEGDTLPIPGAHRPGVVTKAGLILFGNDDRMLLVKNIQLEDGKMI
PASNFFKGEGSSALELTEVELAIAEAVRSAWQRILPNVLEVEDSTDFFKSGAASVDVVRL
VEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEEGEYSIDYVEMAVNKRTLHM
PHQLFIGGAFIDAEGAKTFETINPTDGSVICQVSLPQVTDVDKAVAAAKDAFENGLWGKI
SARDRGRLLYRAPPSPSTKPDPTAT
Download sequence
Identical sequences F6PMU7
ENSCJAP00000012834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]