SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6PMV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6PMV1
Domain Number 1 Region: 2753-2922
Classification Level Classification E-value
Superfamily Cyclophilin-like 5.99e-66
Family Cyclophilin (peptidylprolyl isomerase) 0.00000109
Further Details:      
 
Domain Number 2 Region: 1048-1179
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-48
Family Ran-binding domain 0.000000574
Further Details:      
 
Domain Number 3 Region: 1951-2082
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-46
Family Ran-binding domain 0.0000435
Further Details:      
 
Domain Number 4 Region: 1655-1786
Classification Level Classification E-value
Superfamily PH domain-like 8.15e-44
Family Ran-binding domain 0.00000107
Further Details:      
 
Domain Number 5 Region: 2605-2742
Classification Level Classification E-value
Superfamily PH domain-like 1.79e-42
Family Ran-binding domain 0.0000369
Further Details:      
 
Domain Number 6 Region: 32-190
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000102
Family Tetratricopeptide repeat (TPR) 0.009
Further Details:      
 
Domain Number 7 Region: 1418-1446
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000154
Family Ran binding protein zinc finger-like 0.0012
Further Details:      
 
Domain Number 8 Region: 1354-1381
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000523
Family Ran binding protein zinc finger-like 0.0018
Further Details:      
 
Domain Number 9 Region: 1290-1316
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000628
Family Ran binding protein zinc finger-like 0.0019
Further Details:      
 
Weak hits

Sequence:  F6PMV1
Domain Number - Region: 1228-1255
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000408
Family Ran binding protein zinc finger-like 0.0025
Further Details:      
 
Domain Number - Region: 2420-2460
Classification Level Classification E-value
Superfamily ARM repeat 0.00155
Family GUN4-associated domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6PMV1
Sequence length 2922
Comment (tr|F6PMV1|F6PMV1_MONDO) RAN binding protein 2 {ECO:0000313|Ensembl:ENSMODP00000003555} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=RANBP2 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MRRSKAEVERYIASVQGSAPSPREKSMKGFLFAKLYYEAKEYDLAKRYISTYLNVQERDP
KAHKFLGILYEAEGNIDKAVGCYKRSVELNPTQKDLVLKIAELLCENDATDGRAKYWVER
ASKLFPGNPTIYRLKEQLLDCKGEDGWNQLFDLIQSELYARPDDVYVNIRLVELYRSNKR
LKDAVAHCCEAERNLALRTSLEWYSCVVRTLKEYLESLQCLEANKSNWRTTNKDLLLAYA
NLMLLTLSTKDVQESRELLESFDDALQSVKSFMSGNDELSITFLEMKGHFYMHAGTLLLK
MAQHSEVQWRALSELAALCYLIAFQVPRPKTKLMKGDNAGQNLLEMMAYDRLSQTGHMLL
NLSRGKQDFLKEVVESFANKSGQSALYDALFDSQSPKDKSFLGSDDIRNISIQTPEPEEL
ARYDIGAIRAHNGSLQHLTWLGLQWSSFSTLPAIRKWLKQLFHHLPQETSRLETNAPESI
CLLDLEVFLLGVIFTSHLQLQEKSSFHYNSHQPPCLPLPVCKQLCTDRQKSWWDAAYNLI
HRKAVSGTSAKLRLLVQHEINTLRGQGKHGLQPALLVHWAKSLQKTGSGLNSFYDQREYI
GRSVHYWKKVLPLLKTIKKKSNIPEPIDPLFKHFHSADIQASEVGEYEEEAHITFAMLDA
VDGKTEDAMSAFEAIKNVVSYWNLALIFHRKAEDIENDALSPEEREECKNYLRKSRDYLI
KISDESCTDPAVARKLPVPLESVKEMLNSVMQELEEYSEGGPHCKNGSPRNIDSEIKHST
PSPTKFSLSPSKSYKFSPKTPPRWAEDQNSLLKMICQQVEAIKKEMHELKLNSSNSTISP
HRWPAEAYGTDSMPEGYQGSQNYHGAPLTVATTGPSVYYSQSPAYNSQYLLRTAANVTPT
KAPVYGMNRLTPQQHIYAYPQQMHTPPVQNPPACMFSQEMYGPPLRFDSPATGILSPRGD
DYFNYNVQQTNTNPPLPEPGYFTKPPVVPHPSKSVESRVIEFGKSNFGQPLPGPGKSVFG
TPTSDLANKSHDTDGGSAHGDDDDDGPHFEPVVPLPDKIEVKTGEEDEEEFFCNRAKLFR
FDAESKEWKERGIGNVKILRHKISGKIRLLMRREQVLKICANHYINPDMKLTPNAGSDKS
FVWHALDYADESPKPEQLAIKFKTPEEAAHFKRKFEEAQGILRAATSNISTASQNVRVLK
ETKNQDSKDTAKPDPGHPNFGFQISKKDGLWDCNSCSVKNVATAKKCVSCKNLNPNNKEL
LGPPLVENTPAFKPGTDKTQEGFGLMFAKKEGHWDCNVCLVRNEPTVSKCIACQNTNTTN
KSTPSFNQQTSFKFGQTDISKPSTSDLGTLFPKKEGQWNCSVCLVQNEVSAKKCIACQNP
NSQSQPPHTIPAPTALKLSTSETSKPTKGGFEGMFMKKEGQWDCTVCLVRNESSALKCVA
CGTPNPVSKPVSEPITETSSDFTFGFKSKLSEPSGSQVVTPFKCDFAEKAFKFGSTEQGF
KFGHSEQGNSPSSFTFQVPSSTEAKSTKEGFSFTMPAPAGGFKFGIQESGDQKGSEKSIE
GDAAFKSHDVSNKQTSGDLVFGNSSSTFTFADLAKSSVGEGFQFGKKDPNFKGFSGAGEK
LFSSQSVKMSPKANTSSDIEKDDDAYKTEDNDDIHFEPVVQMPEKVELVTGEEDEKVLYS
QRVKLFRFDAEISQWKERGLGNLKILKNEVNGKLRMLMRREQVLKVCANHWITTTMNLKP
LSGSDRAWMWLASDFSDGDAKLEQLAAKFKTPELAEEFKQKFEECQRLLLDIPLQTPHKL
VDTGRAAKLIQRAEEMKSGLKDLKTFLTNDKKLTEEENSSSGLAVSASDLTLKPHAETTG
PSLEWDNYDLREDALDDSVSSNSVYASPLTNSPVRKNLFRFGDSTTGFNFSFKSALSPSK
SPAKLNQSRTSVGTDEESDVTQEEEKDGQYFEPVVPLPDLVEVSSGEENEQVVFSHRAKL
YRYDKDAGQWKERGIGDIKILQNYDNKHVRIVMRRDQVLKLCANHRVTPDMTLQNMKGTE
RVWVWTACDFADGERKVEQLAVRFKLQDIADAFKQIFDEAKQAQEKDILLTPHSRAITPR
ESPCGKIAVAVLEETTRERTDLNQGSDMTETILEIGEVCSTSETPTKAVVSPPKFVFGSE
SVKSIFSSEKSKPFAFGNNSATGSLFGFSFNAPLKNRSGEDVSGATGRKTEPGKYEPQKN
LDIKPFAENKVEKPLTPFSKGGPSTNYAFKALEKGFNFSLFKSNPMAFWTSTPSSQPESK
AEVKKEPEELYTDEVLIVYELTPTPEQKALAVDLKLPPTFFCYKNRPDYISEEEDDDEDF
ETAVKKLNGKLYPDDPGECKGSQEFVAGDVPGHDKECVIIWEKKPTSDERAKAETLKLPP
TFFCGVCSDTDEDSSHQEDFNSEVQKVQEEKKSQDDDEEEEEEEEEEEEEDEEEEEEEEE
EEEEEEEGEEEDVTSSSGTAFTRETKVPASFICKSEEPDSTTESSDEAHNSSGVNDKPVD
LSNKKENEADSTSQEVESRTLSFGFGTSTGLSFADLASGNSGDFAFGSKDKNFQWANTGA
TVFGMQTVSKGGEDEEGSDEEVVHNEDIHFEPIVSLPEVEVKSGEEDEEILFKERAKLYR
WDRDIVQWKERGVGEIKILFHTMKNYYRILMRRDQVFKVCANHVITKAMELKSLNVSNNA
LVWTATDYADGEAKVEQLAVRFKTKEMSDNFKKRFEECQHNLSKLQKEQVSLVAELSMET
NPVVFFEIFADDEHLGRITIELFSNIVPLTAENFRALCTGERGFGFKNSVFHRVIPDFIC
QGGDITKHDGTGGRSIYGNTFEDENFTVRHTGPGLLSMANRGRDTNNSQFFILLKKAEHL
DFKHVVFGFVKDGMDTVKKIESFGSPKGLVSKRIMITECGQI
Download sequence
Identical sequences F6PMV1
ENSMODP00000003555 ENSMODP00000003555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]