SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6PV96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6PV96
Domain Number 1 Region: 282-449
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-43
Family SPRY domain 0.00012
Further Details:      
 
Domain Number 2 Region: 2-75
Classification Level Classification E-value
Superfamily RING/U-box 3.98e-20
Family RING finger domain, C3HC4 0.0051
Further Details:      
 
Domain Number 3 Region: 94-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000168
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6PV96
Sequence length 457
Comment (tr|F6PV96|F6PV96_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000010855} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MEVKELIENLKAELTCPICLDYFTDPVTTKCGHNFCKDCLFQCNEQTDATLTCPECRDVI
RYSDILLNDKNLQNLSITGKTLRQKLLLSTVLLTTCDQHGEKEKIFCEQDQKLICGSCLL
TQEHKDHQDLPLQMAVDKCKKKLQETLNVLQEKEEELKEEINKMGKTEAYLKKDTDFYKE
LIKCEYQKMHEFLWDEENRHLQKLDQEIEYKLAKVETNKAKLSQQIHYVQRKILQIEESL
YEAPLKMLQDMKDNLERNEEVLRQQTETINLTYTTYQMSGLIEILRNYQTGITLDPETDS
FHLIVPEHFKSLKYKLDPPNQPDKEERLDYFVIMLGTETFTGGKHYWEVDVEGQTEWVLG
ICEDSVSKNENLSMLSEDVRAIIGSKVKNQTLFWSSKDCFYSILQYKVGIFLNYDEGSIT
FYDVNEKIVLISFLNSTFQGPVRPFFSTSLVNKGRTS
Download sequence
Identical sequences F6PV96
ENSMODP00000010855 ENSMODP00000010855 13616.ENSMODP00000010855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]