SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6QXX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6QXX7
Domain Number 1 Region: 23-228
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-57
Family Calnexin/calreticulin 0.0001
Further Details:      
 
Domain Number 2 Region: 212-326
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 7.19e-46
Family P-domain of calnexin/calreticulin 0.000000821
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6QXX7
Sequence length 362
Comment (tr|F6QXX7|F6QXX7_MONDO) Calreticulin {ECO:0000313|Ensembl:ENSMODP00000014423} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=CALR OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
TLPVMLPLLLLGLLGLAEAAGPMIYFKEQFLDGDTWEDRWVESKHKSDYGKFRLSSGNTG
AGNPLPEDNFFTILVGLQTSQDARFYALSSRMESFSNKGQTLVVQFTVKHEQNIDCGGGY
VKLFPANLDQSSMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNMLINKDIRCKDDEFT
HLYTLIVRPDNTYEVKIDNVQVESGSLEDDWDFLPPKKIKDPEAKKPEDWDERAKIDDPT
DTKPEDWEKPEHIPDPDAQKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGKW
LHPEIDNPEYTPDPNLYAYDSFGVLGLDLWQVKSGTIFDNFLVTNDESYAEEFGEETWGA
TK
Download sequence
Identical sequences F6QXX7
ENSMODP00000014423 ENSMODP00000014423 13616.ENSMODP00000014423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]