SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6R091 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F6R091
Domain Number - Region: 9-55
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 0.0157
Family MED7 hinge region 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6R091
Sequence length 88
Comment (tr|F6R091|F6R091_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000026084} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MKAFLPFAVLVVLLFFLAEGPRPAQASSSLAQSFEQFQKKVKEFTETVVEKTKAAITQIK
HSDLPSKTRTWITENIQKVKDKVESTFK
Download sequence
Identical sequences F6R091
ENSMODP00000026084 13616.ENSMODP00000026084 ENSMODP00000026084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]