SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6R9M2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6R9M2
Domain Number 1 Region: 933-1068,1132-1198
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.14e-36
Family Hemopexin-like domain 0.00084
Further Details:      
 
Domain Number 2 Region: 74-113
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000183
Family Somatomedin B domain 0.0013
Further Details:      
 
Domain Number 3 Region: 33-73
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000562
Family Somatomedin B domain 0.0014
Further Details:      
 
Weak hits

Sequence:  F6R9M2
Domain Number - Region: 260-371
Classification Level Classification E-value
Superfamily Phage fibre proteins 0.0942
Family Tail-associated lysozyme gp5, C-terminal domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6R9M2
Sequence length 1198
Comment (tr|F6R9M2|F6R9M2_ORNAN) Uncharacterized protein {ECO:0000313|Ensembl:ENSOANP00000001622} KW=Complete proteome; Reference proteome OX=9258 OS=Ornithorhynchus anatinus (Duckbill platypus). GN=PRG4 OC=Mammalia; Monotremata; Ornithorhynchidae; Ornithorhynchus.
Sequence
MQTMKTIMEWKILYIHLALLSLFLIEEASSQDVSSCAGRCGEGYSRTDACHCDYNCQHFM
ECCPDYKKVCTKELSCKGRCFESFVRGRECDCDAACTKFGKCCPDYQSFCEERQDSKKKR
TTKDKPTPPPPTVDEGRSGADDAGFEPTPLPESPSPRPNEAVPTTKATTAHPEVSLPPSG
PASTAEVSLKETSTSTKETTATTAKETSTTVKETVTTAKRTSTTAKETASAAKQTATTGS
KPASEVPTPPAVMTTTAGKETTTEGKETTTAGKETTTTAGKETTTTEGKETTTTEGKETT
TTEGKETTTTEGKETTTTEGKETTTTEGKETTTTEGKETTTEGKETTEGKETTTTEGKET
TTTEGKETTTTESKETTTAKQTVAPTTVASPSSKIVTSEPPSTPEDKTLTSKTASTTIKV
TTTKDTSTAPKVTTTKITTTTTEETTSNPGDTTVTTDKISVAPKDTTMAPRETPADPGAP
TAPPSEKIPTASEPTTAPASDETLAPEETPVTSEAATAPAPDEASAPKETSVTPKATTAP
APDEASAPKETSVTPKATTAPAPDEASAPKETSVTPKATTAPASDETPVPKETSVTPALD
EASAPQETPVTPEATTTPAPDKTPAPKETPVAPQATTTPASDETPVPKETPVTSKATTTP
APDETSVPEKTPAASKASTTPALDEASAPKDTPATPKSTTTPAPGKTPAPKKTPATPKST
TTPAPGKTPAPKKTPATPKSTTTPAPGKTPAPKKTPATPKSTTTPAPDRTPAPKKTPATP
KSTTTPAPDGTPAPKKTPAASKATTTPAPDGTMPTKVTIATVKTSTPKIPSKEITAPGTL
TMVGRQEDPSSLAESPIRVPIAPTRTPKPERPDAPVGPEDVSESVIPALPELEEQLMIPR
PPAFNPLAVPGATFILRPNQNGASNPVLSDEMNLCNGKPVDGLTTLRNGTLVAFRGHYFW
MLNPFTPPSPPRRITEVWGIPSPIDTVFTRCNCEGKTFFFKDSQYWRFTNDVKDAGYPKQ
IFKGFGGLNGKIVAALSIAKHKNRPESVYFFKRGGSMQQYTYQHEPTKKCTRQKPAVTYP
IYGQTTLVRRRRYDRAVPPYQTYHHTIRINYPPSYQTVKVSYPVGVLHNEVRMNTQWRGF
PKVITSAIALPNPRKPDGYDYYSFSKDRSYSIDVPTRTARAITTRSGQTLSKAWYNCP
Download sequence
Identical sequences F6R9M2
ENSOANP00000001622 ENSOANP00000001622 XP_007667178.1.37387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]