SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6RAU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F6RAU7
Domain Number - Region: 357-409
Classification Level Classification E-value
Superfamily Prefoldin 0.0732
Family Prefoldin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6RAU7
Sequence length 409
Comment (tr|F6RAU7|F6RAU7_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000036281} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
PARQCFLETPTGPLSHSHHREDVNQLLSDDQAWEKFVAEWAFMSLEDPDKITDDPDKITG
DPDKITGDINENMAHKEMEQELDMLLTNADDLKKDNDDISSYGEAFDNLEDLEDPDKITD
DPDKVTDDPDKITDDPDENMDNFDENMAFEKMEHELDMFLCKYPRLKLELEKYIQNLYST
ADNIDEIHKDCTITNVVAGSTGVVSGILTIMGIALAPVTAGGSLALSITGIGLGAAATVT
GVSAGIIDHVNDLKGRKLLSEVEGNTNANVAEKVLFKEASKLFSTLNKHSQIFKDFDNHW
KAFQVTKTNPHLMEASHRLMTGAQISSKNRRQINKAFRGTTLALTKQGRIQSATLAGASI
LVDVTNIVKDSMHLSNGAKTTTAMKLREYAQALEKKLEELSNHFEKLQK
Download sequence
Identical sequences F6RAU7
ENSMODP00000036281 ENSMODP00000036281 13616.ENSMODP00000036281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]