SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6RCV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6RCV4
Domain Number 1 Region: 44-159
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-34
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 2 Region: 174-297
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-18
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 3 Region: 296-332
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000838
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6RCV4
Sequence length 525
Comment (tr|F6RCV4|F6RCV4_MACMU) Neuropilin and tolloid-like protein 2 isoform 1 {ECO:0000313|EMBL:AFE63926.1} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=NETO2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MALERLCSVLKVLLITVLVVEGIAVAQKTQDGQNIGIKHIPATQCGIWVRTSNGGHFASP
NYPNSYPPNKECIYILEAAPRQRIELTFDEHYYIEPSFECRFDHLEVRDGPFGFSPLIDR
YCGVKSPPLIRSTGRFMWIKFSSDEELEGLGFRAKYSFIPDPDFTYLGGILNPIPDCQFE
LSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQMEHSNECKRNFVA
VYDGSSSIENLKAKFCSTVANDVMLKTGIGVIRMWADEGSRLSRFRMLFTSFVEPPCTSS
TFFCHSNMCINNSLVCNGVQNCAYPWDENHCKEKKKAGVFEQITKTHGTIIGVTSGIVLV
LLIISILVQVKQPRKKVMACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELD
NYQKMRRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKK
SSYTFKQGHECPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF
Download sequence
Identical sequences F6RCV4
9544.ENSMMUP00000006268 ENSMMUP00000006268 ENSMMUP00000006268 NP_001252988.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]