SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6RG77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6RG77
Domain Number 1 Region: 142-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000952
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 1179-1228
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000026
Family Myb/SANT domain 0.0039
Further Details:      
 
Domain Number 3 Region: 177-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000111
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Weak hits

Sequence:  F6RG77
Domain Number - Region: 841-870
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000848
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6RG77
Sequence length 1371
Comment (tr|F6RG77|F6RG77_MONDO) Zinc finger protein 541 {ECO:0000313|Ensembl:ENSMODP00000010925} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=ZNF541 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MDQYSLGDDGALQSEMHLPGFSESQGLNCSDTLNRDLCPNTRDLLYAGLSSLDLDPGLPT
PDMASEALEDNLDALSLYSGKEGDSAKLLEEYADSDSQPSLQDLGLGVLKASKEADEGGR
ASSGSARKGKRQHSSPQNPFLDCSLCGKVFSSASSLSKHYLTHSQERKHVCKICSKAFKR
QDHLTGHMLTHQKTKPFVCIEQGCSKSYCDYRSLRRHYEVQHGLCILKEAPPEEEACGDS
PHAHEAASQPGPSSLRPLVPSEARSPSSLLPNRDLLRCIVSSIVHQKLPSPGPATAGAPD
IDGRASLGPCPPSAGSVSCTPASALAPTGALGIETPEEPRPPRKDAAPSDMFTVIHSGNL
AAMAPGGENGASDPADSELPFLPLPSAGLESWSDGGTLPCLPLFRGQAVSASSQPSSHNF
QWVRNLPGCPKSKGNSVYVVHKPPAVSARDASEPGPGPGAVSPLLDPLAPAGTGPEDVLS
FPPTLLKAPGDALSDARFAGGEDSSWPSQRNKYDCEPFPWQSPGELGLQDVQKPSGLPPE
STPLFRQLFLKSQESLVSHEQMQVFQMITKSQRIFSHTQVAAAPSQLPLPETKQALLKPL
QGVWQQPLAPGADSFHALPGNPEQEGSPARRRKTQALFPRESSPGSTRRDSKGGPKGAPT
LPSLGSSLDPCGNPDPSITKQLRSAKGNVGLGDVFSPAHTRPSPSGAEEPSGGQFHSKLS
QAENGASSATKSDKSQACAREMGYRLFSGSTRAQRFSGFRKDKVKMDMCCAASPSQVAMA
SFSSAGASADPARDMKSKLTIFNRIQGGNIYRLPNPAREESLVTGCDQLNGVSPAWTEPR
SSYVCKNCSQMFYTEKGLSSHMCFHSDQWPSPRGRQEQQVYSAEYCKPQRLVLRPEGEGQ
SSPGAKRPLEDLAAAPLVTPVSVPVPAGSRPPGSLAKGHERASREERDTKETSQHRKRKK
RPQPKALFIPPPTSVFGEIQPGPGGCYQSCLRSPVFLVDHLLKGLFQCSPYTPPPMLSPI
REGSGLYFNTLFSTSSHSGPDRLYGAVLDQVDGSFGIAVVKDDTKISIEPHINIGSRFQA
EIPKPRESSLAESDQHGASLVWKPWGDVMTNPDTQDRVTELCNVACSSVMPGGGTNLELA
LHCLHEAQGDIRDALETLLLRGPQKAPSHPLADYRYTGSDIWTPVEKRLFKKAFCAHKKD
FYLIHKTIQTKNVAQCVEYYYIWKKMIKFDCGRAPGLEKRVKREQDEVERTEEKVACSPR
DRLSHRPTPELKIKTKSYRREASVTSSPTIGPKRTPEPPGSAESQGVFPCRECERVFDKI
KSRNAHMKRHRLQEHVEPLVRMKWPVKPFRSEPREEEDEEEAGAEGGPLRW
Download sequence
Identical sequences F6RG77
ENSMODP00000010925 ENSMODP00000010925 XP_007492015.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]