SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6RHL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6RHL7
Domain Number 1 Region: 1122-1288,1317-1371
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.46e-39
Family Hemopexin-like domain 0.0011
Further Details:      
 
Domain Number 2 Region: 69-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000157
Family Somatomedin B domain 0.0015
Further Details:      
 
Domain Number 3 Region: 29-68
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000418
Family Somatomedin B domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6RHL7
Sequence length 1383
Comment (tr|F6RHL7|F6RHL7_XENTR) Proteoglycan 4 {ECO:0000313|Ensembl:ENSXETP00000037876} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=prg4 OC=Silurana.
Sequence
AGWCFGILYLLNLLLHIFWVYENQFIGEGSCVGRCGEGYFRGHTCHCDYNCMSFMECCRD
FKAVCTTENSCRGRCHEGFIRGQACDCDPNCLNYGKCCPDFESMCAKLSSTNLSMPPSDP
KMSSPSSKPTKKSMKKHPKNPRKKKNKNVLDPKEDTEDSNPDANEKATSSPSLKPSPRKN
KKRKVTFTTVKPAKRRRKIIIEYEDESEVKKWPPIATSCSFLHVTNAFLLCTLSLKSPDE
DTGTTPSTVITPQPVKEKKQMPKKPKKPKKLVEAEEEIEVETEENETSSTFSTTRTKGTT
IKVTRKDSKKKKPKDKNLNPKANSTEPGRGSFSPSVPPPPDKNADILMTPQTPRVGDDAA
DPVGSQEGNNSTDNPSSSTTPKTTKKRSPSNTNKKKINKKQENEESPSSNNKKKPPSKPS
PKDIKRKKGTDPKDEKQDPAKGPDPSAKKDTKKPVSKGPKKRIITEPQKPVKKKPSKKPS
PKDTKRKKKFNPKETTPSATSLSDSSPKETLFSTIMDGTISSSVMPRTENIVITSDKNTE
TPKALSTVEPSLRTTPGMNIFTDVSTVSKEPFKQTETPAQPTEESTKKSTINNWTPYTTQ
PMKTEEVDKNTPLFKEEKYTLNITVTETTQSGQTSPTNETPKTAVKKSTQFPADSSALVT
VESSPDHLVGSSFPTVDAPQSLSSAQVTSTSQSQSSTLSRGLHGELLSTVATESLGATSE
KDMLHTPEAQSLTDMLKTVPNERNTEGTFSPKTPDIAFVEPTQWQQTDRTHKAPQPEELT
QSSTVTMDSGTRDLSSLKILDTTPNIHTTNQHTGDSKVDVLTEHSTNPNVETKETTTGGQ
EKSSTINKSPDERPMISVTEATQIPLEITESSAPFRISTSPAMTIKQFIVTTEEQKIDLS
PAASISSDMSEKPRTYSKTDVQTEKTLSTEKSLTTVLVSSITTNETTRGNMADLETTTVN
TKDSSRVQTLTNLVTQYLNNQQSTESTGERDTDHSLNTPISTDPSSVSLPVTKSESPVTQ
LPELSSQYTINTPESTTETFPKLSSSTKEETATTTPTTQPMESVSTTTQVNVASQQATTT
SSENQQEHTTKDVTTNTVKSDLEQRPTVPNQNSVNNCFALDPQMNLCNGQPADGMTTLQN
GSMVVFRGHYFWTLNQGGAVRQARKISDVWGIPSPIDTVFTRCNCAGKTFFFKGPRYWRF
TNDVMDKGYPKEIIKGFGGLKGKITSVLSVAGFKTRPESVYFFKGGGNVQKYTFRQEQSK
RCTKKKQPNVQYPIYSHNIQTVKYRYPRDVVKQQRKIQRTIITIKQEPLGVLHQEISIRS
TWRGIPNNIVSAISLPNSQKQDGFDYFVFSKEKYYNINMSSKVAIKPPPNSEQKISKDWY
KCK
Download sequence
Identical sequences F6RHL7
ENSXETP00000037876 ENSXETP00000037876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]