SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6RNU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6RNU7
Domain Number 1 Region: 126-183
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.25e-27
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 238-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 406-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 182-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.4e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.59e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 6 Region: 294-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 7 Region: 71-127
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.53e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 8 Region: 452-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.88e-21
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 9 Region: 14-71
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6RNU7
Sequence length 509
Comment (tr|F6RNU7|F6RNU7_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000024955} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
GHFIFTHFRKVPTSFNKSSKLILHQRIHVGENPCECNVCGKGFHHRSKLNIHQRAHTRKS
PYQCNDCGKMFINDSKLILHQRIHTGEKPFKCNDCGKFFSHRSKLIIHQRIHTGEKPFKC
HDCGKAFIRSSHLLQHQRIHTDEKPFKCDECGKAFNQNSNLLQHQRIHTGEKPFKCDDCG
KAFNRNSNLLQHQRIHTGEKPFQCNDCGRTFNQNSNLSDHQRIHTSEKPFQCDDCGKAFN
RSSHLLQHQRIHTGEKPFKCDDCGKAFNQSSHLFKHQRIHTGEKPFQCHDCGKAFNQSSH
LLQHQRIHTGEKPFKCHDCGKAFNQNSNISVHQRIHTSERPFQCNDCGKAFKQSSHLLQH
QTIHTGEKPFQCHDCGKAFNQSSHLLQHQRIHTGEKPFECHDCGKAFNQNSNLSVHQRIH
TSERPFKCNDCGKAFNQSSHLLQHQRIHTGDKPFKCNDCGKAFSQRSKLIIHQRIHTGEK
PFKCNDCEKAFNRSSTLLKHQRIHTGEKP
Download sequence
Identical sequences F6RNU7
ENSMODP00000024955 ENSMODP00000024955 13616.ENSMODP00000024955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]