SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F6S6P1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6S6P1
Domain Number 1 Region: 80-194
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 1.26e-45
Family P-domain of calnexin/calreticulin 0.000000628
Further Details:      
 
Domain Number 2 Region: 1-96
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-31
Family Calnexin/calreticulin 0.00078
Further Details:      
 
Weak hits

Sequence:  F6S6P1
Domain Number - Region: 185-227
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0506
Family Calnexin/calreticulin 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6S6P1
Sequence length 296
Comment (tr|F6S6P1|F6S6P1_CALJA) Calreticulin {ECO:0000313|Ensembl:ENSCJAP00000045776} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=CALR OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNT
YEVKIDNSQVESGSLEDDWDFLPPKKIKDPAASKPEDWDERAKIDDPTDSKPEDWDKPEH
IPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSP
DPNIYTYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQ
DEEQRLKEEEEDKKRKEEEEAEDKDDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL
Download sequence
Identical sequences F6S6P1
ENSCJAP00000045776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]