SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6S9U5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6S9U5
Domain Number 1 Region: 34-501
Classification Level Classification E-value
Superfamily Cytochrome P450 1.31e-126
Family Cytochrome P450 0.00000000000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6S9U5
Sequence length 508
Comment (tr|F6S9U5|F6S9U5_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000000961} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MNIIPSLSAGTWTLIVLFLTLLYLYGTRTHKLFKNLGIPGPTPLPFFGTVLAYRKGFADF
DYGCFKKYGKTWGFFDGRQAVLAIMDPETIKTVLVKECYSVFTNRRMFGPSGFLEKAISI
AKDEQWKRIRTVLSPTFTSGKLKEMFPIINQYGDVLVKNMKKEAEKSKPVTMKEIFGAYS
MDVITSTSFGIHVDSLNNQNDPFVREIKKLIRFSFLDPLILSTTIFPFLIPLFNKLDITV
FPKEATDFLAKSIIKIKEERTKSTEKASRPLQYFLQLMMDSQTSKNSESHSQKDLSDEEI
LAQSIIFIFAGYETTSSVLSFLFYHLATNPKIQEKLQKEIDAFLPNKEAVTYDALVQMEY
LDMVINENLRLYPIAGRIERVAKKTVELNGLTIPKGTVVMAPPYVLHRDPEYWPEPEEFR
PERFSKENKESINPYVYLPFGAGPRNCIGMRFALMSMKVAVSRLLQEFSFRPCKETQIPL
KLSNQPLLTPTVPIVLQAELRNKKGNQH
Download sequence
Identical sequences F6S9U5
13616.ENSMODP00000000961 ENSMODP00000000961 ENSMODP00000000961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]