SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6SFE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6SFE6
Domain Number 1 Region: 316-394
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.36e-25
Family Intermediate filament protein, coiled coil region 0.00000687
Further Details:      
 
Domain Number 2 Region: 89-126
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000000115
Family Intermediate filament protein, coiled coil region 0.00025
Further Details:      
 
Weak hits

Sequence:  F6SFE6
Domain Number - Region: 139-229
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0191
Family Myosin rod fragments 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6SFE6
Sequence length 454
Comment (tr|F6SFE6|F6SFE6_MONDO) Vimentin {ECO:0000313|Ensembl:ENSMODP00000012279} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=VIM OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MFGGSSTGGRPSASRSYVTSTTRYSLGSAIRPSTTRSVYSSSPGAVYATRSSAARLRSSA
PIPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILL
AELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEE
MLQREEAESTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHDEEIQELQAQIQEQ
HIQIDVDVAKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQA
KQESNEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNM
KEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRIALPLPNFSSLNLRETNLDSLP
LVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE
Download sequence
Identical sequences F6SFE6
ENSMODP00000012279 ENSMODP00000012279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]