SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6SLB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6SLB3
Domain Number 1 Region: 2-430
Classification Level Classification E-value
Superfamily ALDH-like 1.2e-133
Family ALDH-like 0.00000000000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6SLB3
Sequence length 450
Comment (tr|F6SLB3|F6SLB3_CALJA) Aldehyde dehydrogenase {ECO:0000256|PIRNR:PIRNR036492} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=ALDH3A1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
ISETVRRARAAFNSGRTRPLQFRIQQLEALRRMIQEREQELAGALAADLHKSEWTAYYEE
VVYVLEEIEYMIQKLPEWASDEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNLTIQ
PMVGAIAAGNAVVLKPSELSENMASLLATIIPQYLDKELYPVINGGVPETTELLKERFDH
ILYTGSTGVGKIVMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKYMNSGQT
CVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRIISARHFQRVMGLIEGQKV
AYGGTGDAASRYIAPTILTDVDPQSPVMQEEIFGPVMPIVCMRSLEDAIQFINQHEKPLA
LYVFSSNDKVIKKMIAETSSGGVTANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFETFS
HRRSCLVRSLMNDESLKARYPPSPAKMTRH
Download sequence
Identical sequences F6SLB3
ENSCJAP00000045115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]