SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6SRK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6SRK3
Domain Number 1 Region: 2-213
Classification Level Classification E-value
Superfamily ALDH-like 8.12e-78
Family ALDH-like 0.0000000565
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6SRK3
Sequence length 218
Comment (tr|F6SRK3|F6SRK3_CALJA) Aldehyde dehydrogenase 1 family member B1 {ECO:0000313|Ensembl:ENSCJAP00000019674} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=ALDH1B1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MEHAVEQCHEALFFNMGQCCCAGSRTFVEASIYNEFLERTVEKAKQRKVGNPFELDTQQG
PQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFG
PVQPLFKFKKIEEVIERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCH
TPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS
Download sequence
Identical sequences F6SRK3
ENSCJAP00000019674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]