SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6SSQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6SSQ6
Domain Number 1 Region: 362-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.69e-20
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 458-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-19
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 3 Region: 203-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.91e-19
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 420-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 145-201
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.99e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 242-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.15e-16
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 7 Region: 1-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000262
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 8 Region: 298-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000347
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 109-161
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000299
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6SSQ6
Sequence length 517
Comment (tr|F6SSQ6|F6SSQ6_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000000924} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
VTFQDATVGFTQKEWSQLAHTQKSLYQEVTLKNYENFVSVAEIPGSKPELISQLECRKGP
WMLLEEEVRSLCQDWEIQSDTKKTFSNQYIYLEDKSQERLAKDKILNRTKVHKCNQFMKS
FNQNPILDTPRSITYIIQHQGIHDGERPSKCSDCGKAFSNRLFVHQRIHTGEKLCRCDIC
EKAFSQKGHLSEHQRIHTREKLLFQHQKFHNGEKPYDCSECGKDFSQKGDLTKHPRTHSG
EKPYKCNKCGKAYSISSQLNIHEKIHTREKPYKCNLYEKIFIQKGPLNEHQKIPIGMESH
VCLECGKDFLHSIGLSLYQRKIHNGEKSYTCSDFRKAFTQRGHITKHQRVHSGEKPYKCK
ESFSNSSQVTLHYRMHTREKPYKCHECGQAFSHPGSLREHQKIHSVEKSYKCSECGKVFS
HNLSCHQTFHIGEKCYPCNECSKAFQNDHYLTLHQRIHRGEKPYKCNECGKAFGRKLYLT
QHQRIHNGEKPYECTTCSKAFTQGTTLIQHQKIHTRN
Download sequence
Identical sequences F6SSQ6
13616.ENSMODP00000000924 ENSMODP00000000924 ENSMODP00000000924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]