SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6T1S9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6T1S9
Domain Number 1 Region: 44-551
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 2.71e-187
Family Myeloperoxidase-like 0.000000000000374
Further Details:      
 
Domain Number 2 Region: 2-40
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000379
Family EGF-type module 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6T1S9
Sequence length 553
Comment (tr|F6T1S9|F6T1S9_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000038593} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=LOC100016853 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
TVNPCCYYPCQNKGICIHFELDQYHCDCTRTGYYGPNCTTPLLWTKISKHLYPSHSFVHF
LLTHASWIWKLINATFLRDVLMRLIITSRTNLIPSPHIYNSYHNYMNWESYSNLSYYSRV
LPPVPEDCPTPMGVKGKKQLPDPEVLVTNFLIRKKFVPDPQGTNLMFAFFAQHFTHQFFK
TSLKLGSAFTSALGHGVDLSNVYGDNLKRQYQLRLFKDGKLKFQMVDGEMYPPSVAETQA
SMNYPPTVPKVYQMAVGNEQFGLLPGLMMYATLWLREHNRVCDILKSEHPTWKDEQLFQT
ARLILIGETIKIVIEEYVQHLSGYYLKLKFDPEMLFGVPFQYQNRISLEFNHLYHWHPLI
PDVFVVGDKEYNYKQFVFNTSMLLDYGVETLVNDFSSQRAGKIAGINNVNHNLRTVAENT
IRVSRRLKFQSFNEYRKRFGLKPYTSFQELTGENEKSAELEKLYGDIDAVEFYPGLLLEK
SLPNSSLGESIVNIGSSFSLKGLLSNPICSPEYWKPSTFGGQVGFNLVKTATLQKLVCLN
VKKCPYVSFRVPE
Download sequence
Identical sequences F6T1S9
ENSMODP00000038593 ENSMODP00000038593 13616.ENSMODP00000038593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]