SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6T3F2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6T3F2
Domain Number 1 Region: 101-202
Classification Level Classification E-value
Superfamily POZ domain 6.28e-23
Family BTB/POZ domain 0.02
Further Details:      
 
Domain Number 2 Region: 264-380
Classification Level Classification E-value
Superfamily POZ domain 2.75e-19
Family BTB/POZ domain 0.0079
Further Details:      
 
Domain Number 3 Region: 7-88
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000859
Family Ankyrin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6T3F2
Sequence length 415
Comment (tr|F6T3F2|F6T3F2_CIOIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSCINP00000029288} KW=Complete proteome; Reference proteome OX=7719 OS=Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis). GN= OC=Phlebobranchia; Cionidae; Ciona.
Sequence
MTYQAQLFQCCREGDLQKAQFLHEEKDVDLNLRDIWDSSPLYYACLCGHFELVEYLLQNG
AKCVENSFDGERCLYGALTNDIKNLIKNWKQVHTRGLRRERHYDMMRSLLDKGSFYDVIM
NVHGRQFKVHRYILSARSEYFADAFSNKWKNVDEVNISHHAVTADAFACLLQYLYTGRMD
IQCDMVGQVKRLAKNCRLDLLHQEIIKVELRCWFKIKKYGLKIKTILTYPTHTHCMFRDD
LRKLVDHVIPPSLHDWVEDGILPFTKMWRETLLFPDVCFNIDNHLFLGHKAIFCACSDYF
TALFEDHFLENSFHSGTRVLPMITLTHISPQIFKNVVVSMYSDEVEFTSMDTAYETMCTS
HMLLFHGLTRRCGQILGQHLDESNLFPLLEVARNFDLPKLEDMCAMYMAKGLNKL
Download sequence
Identical sequences F6T3F2
ENSCINP00000029288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]