SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6T5R8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6T5R8
Domain Number 1 Region: 215-713
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 5.49e-171
Family Aconitase iron-sulfur domain 0.00000000000789
Further Details:      
 
Domain Number 2 Region: 717-970
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 2.35e-72
Family LeuD-like 0.0000000161
Further Details:      
 
Domain Number 3 Region: 15-145
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 4.32e-26
Family Aconitase iron-sulfur domain 0.00000648
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6T5R8
Sequence length 972
Comment (tr|F6T5R8|F6T5R8_CALJA) Iron responsive element binding protein 2 {ECO:0000313|Ensembl:ENSCJAP00000019077} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=IREB2 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MDAPKAGYAFEYLIETLNDSSHKKFFNVSKLGGTKYESDALPYSIRVLLEAAVRNCDGFF
MKKEDVVNILDWKTKQSNVEVPFFPARVLLQDFTGIPAMVDFAAMREAVKTLGGDPKKVH
PACPTDLTVDHSLQIDFSKWNDSAIQNAPNPGGGDLQKAGKLSPLKVQPKKLPCRGQTTC
RGSCDSGELGRNSGTFPSQIENTPILCPFHLQPVPEPETVLKNQEVEFGRNRERLQFFKK
IQWSSRVFKNVAVIPPGTGMAHQVNLEYLSRVVFEEKDLLFPDSVVGTDSHITMVNGLGI
LGWGVGGIETEAVMLGLPVSLILPEVVGCELTGSSNPFVTSIDVVLGITKHLRQVGVAGK
FVEFFGSGVSQLSIADRTTIANMCPEYGAILSFFPVDNVTLKHLEHTGFSKAKLESMETY
LKAVKLFRNDQNSSGEPEYSQVIQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEK
VGFKGFQIAAEKQKDIVSIHYEGSEYKLSHGSVVIAAVISCTNNCNPSVMLAAGLLAKKA
VEAGLHVKPYIRTSLSPGSGMVTHYLSSSGVLPYLSKLGFEIVGYGCSTCVGNTAPLSEA
VLNAVKQGDLVTCGILSGNKNFEGRLCDCVRASYLASPPLVVAYAIAGTVNIDFQTEPLG
TDPTGKNIYLNDIWPSREEVHRVEEEHVILSMFKALKEKIEMGNKRWNSLEAPDSVLFPW
DLKSTYIRCPSFFDKLTKEPVALQPIENAHVLLYLGDSVTTDHISPAGSIARNSAAAKYL
MNRGLTPREFNSYGARRGNDAVMTRGTFANIKLFNKFIGKPAPKTIHFPSGQTLDVFEAA
ELYQKEGIPLIILAGKKYGFGNSRDWAAKGPYLLGVKAVLAESYEKIHKDHLIGIGIAPL
QFLPGENADSLGLSGRETFSLTFPEELAPGITLNIQTSTGKVFSVIASFENDVEITLYKH
GGLLNFVARKFS
Download sequence
Identical sequences F6T5R8
ENSCJAP00000019077 ENSCJAP00000019077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]