SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6T6S6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6T6S6
Domain Number 1 Region: 67-351
Classification Level Classification E-value
Superfamily L domain-like 1.7e-52
Family Ngr ectodomain-like 0.0072
Further Details:      
 
Domain Number 2 Region: 371-675
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 7.05e-43
Family Rhodopsin-like 0.00051
Further Details:      
 
Domain Number 3 Region: 25-64
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000615
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6T6S6
Sequence length 724
Comment (tr|F6T6S6|F6T6S6_MACMU) Relaxin/insulin like family peptide receptor 1 {ECO:0000313|Ensembl:ENSMMUP00000006183} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=RXFP1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MTSGPVFFYILIIGKYFSHGGGQDVKCSLGYFPCGNITKCLPQLLHCNGVDDCGNQADED
NCVVSSVPVQCLCQGLELDCDETNLRAVPSVSSNVTAMSLQWNLIRKLPPDCFKNYHDLQ
KLYLQNNKITSISIYAFRGLNSLTKLYLSHNRITFLKPGVFEDLHRLEWLIIEDNHLSRI
SPPTFYGLNSLILLVLMNNVLTRLPDKPLCQHMPRLHWLDLEGNHIHNLRNLTFISCSNL
TVLVMRKNKINYLNENTFAPLQKLDELDLGSNKIENLPPLIFKDLKELSQLNLSYNPIQK
IQANQFDYLVKLKSLSLEGIEISNIQQRMFRPLMNLSHIYFKKFQYCGYAPHVRSCKPNT
DGISSLENLLASIIQRVFVWVVSAVTCFGNIFVICMRPYIRSENKLYAMSIISLCCADCL
MGIYLFVIGGFDLKFRGEYNKHAQLWMESTHCQLVGSLAILSTEVSVLLLTFLTLEKYIC
IVYPFRCVRPGKCRTITVLILIWITGFIVAFIPLSNKEFFKNYYGTNGVCFPLHSEDTES
IGAQIYSVAIFLGINLAAFIIIVFSYGSMFYSVHQSAITATEIQNRVKKEMILAKRFFFI
VFTDALCWIPIFVVKFLSLLQVEIPGTITSWVVIFILPINSALNPILYTLTTRPFKEMIH
QFWYNYRQRRSMDSKGQKTYAPSFIWVEMWPLQEMPPELMKPDLFTYPCEMSLISQSTRL
NSYS
Download sequence
Identical sequences A0A2K5VSJ4 A0A2K6CPX2 F6T6S6
ENSMMUP00000006183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]