SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6T8Z3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6T8Z3
Domain Number 1 Region: 110-164
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.08e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 51-106
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 18-65
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000458
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6T8Z3
Sequence length 170
Comment (tr|F6T8Z3|F6T8Z3_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000029771} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
RGQRCHMCEAICLFSSSQQCGKTFSHSSSLCVHERIHTGNKPYECKKCGKSYSQKSHLAV
HQRMHTGEKPYECKQCGKSFRLSCTFAVHQRIHTGHKLYECKQCRRTLSTNFRLAIHQRT
HTGEKPYECKQCGKAYSRRYSLAVRQRTHTGEKPYECKHCGKAFTNNSSF
Download sequence
Identical sequences F6T8Z3
13616.ENSMODP00000029771 ENSMODP00000029771 ENSMODP00000029772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]