SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6TBX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6TBX7
Domain Number 1 Region: 287-454
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-43
Family SPRY domain 0.0000735
Further Details:      
 
Domain Number 2 Region: 9-75
Classification Level Classification E-value
Superfamily RING/U-box 1.33e-17
Family RING finger domain, C3HC4 0.0096
Further Details:      
 
Domain Number 3 Region: 93-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000153
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6TBX7
Sequence length 462
Comment (tr|F6TBX7|F6TBX7_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000036568} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MEAKDLIKSLKAELTCSICLGYFTDPVTALKCGHTFCKDCLFQCDEQADATLTCPECRAV
IRYSDVVLNENLQNLSITGKTLRQHLLLSPALLTTCDQHGEKEKLFCEQDQKLICDSCLL
TQEHKDHQDLPLQMAADKCKKKLQETLNVLQEKEEELKAEISKIGKEVEYFKKDTDFYKE
VIKCEYRKMHEILYIEENRHLQKLDQEREDKLAKVEANKAKLSQQIQHVQQKILEIEESL
DEAPLEMLQQGWGVVICSTELLKCSVFPYLPQTVNLTYTIYPMTGLIEILRSYQTGITVD
PEIDTLHLIVPEHYKSLKYRLDPRNQPDKEERLDYFVTVLGTETFTSGKHYWEVDVEGQT
EWVLGICEDSVSKNENVSILSEDVKAIIGSKVKNQGFFWSSEGCFSSIPPCKMGVFLDYD
EGNITFYDVHENIVLIGFLHLAFRGPVRPFFSTSFVNKGSSS
Download sequence
Identical sequences F6TBX7
ENSMODP00000036568 ENSMODP00000036568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]