SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6U048 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6U048
Domain Number 1 Region: 20-194
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.56e-30
Family Laminin G-like module 0.00000107
Further Details:      
 
Domain Number 2 Region: 216-393
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000343
Family Laminin G-like module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6U048
Sequence length 403
Comment (tr|F6U048|F6U048_MONDO) Sex hormone binding globulin {ECO:0000313|Ensembl:ENSMODP00000038514} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=SHBG OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MEGLRSLTLLLLLLLWPPETWEELAPDLSLPTKISRDPAVLHLGSGLGQKPVTVMAFNLS
QVTRAISSFELRTWDPEGVIFYGDTNPKDDWFVLGLRGGRLEVQMYNLWARLTVGAGPRL
DDGHWHQLEIKNQRDSVFLEVDGDEVLRLSQVSRPLAGTALPIMRIALGGLLFPPTDLHL
PLNPALDGCLRRHIWLNQPGSAVPFSHPPQGACSLKAQPGTFFPPRAHTVFSLKDLPQPS
VDPWTFSLELRLQFFGGSGGLLSLGILGNHSLLSLDLQDQILVLSAKLPQQIEMDSKSLP
LSPGTVIQLELSLTRVAVSQGPHEVAFILPPLLLVSLLDLWTQPKGSLLLGVAPGETSSA
FFCLDGLRVQGRELDVDEALSRSKNIWSHSCPGSLNNSTNTPH
Download sequence
Identical sequences F6U048
XP_001369545.2.35504 ENSMODP00000038514 ENSMODP00000038514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]