SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6UAR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6UAR3
Domain Number 1 Region: 681-828
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.32e-41
Family Regulator of G-protein signaling, RGS 0.0000737
Further Details:      
 
Domain Number 2 Region: 1012-1109
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.17e-30
Family Ras-binding domain, RBD 0.001
Further Details:      
 
Domain Number 3 Region: 17-96
Classification Level Classification E-value
Superfamily PDZ domain-like 2.8e-21
Family PDZ domain 0.015
Further Details:      
 
Domain Number 4 Region: 223-366
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-20
Family Phosphotyrosine-binding domain (PTB) 0.01
Further Details:      
 
Domain Number 5 Region: 957-1026
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000568
Family Ras-binding domain, RBD 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6UAR3
Sequence length 1368
Comment (tr|F6UAR3|F6UAR3_XENTR) Regulator of G protein signaling 12 {ECO:0000313|Ensembl:ENSXETP00000012080} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=rgs12 OC=Silurana.
Sequence
MYRPADPMKSRLKMQVSSRLRSVEVARGRTGYGFTLSGQSPCVISSVIKESPAEFVGLKP
GDQICAVNEINVKNASHEDVVKLIGKCSGVLHMVIAEVIRHIDSCSSDEELAFYEGKTCL
KPRPDSKALGINRAKRVVEEMQSGGIFNMIFEKPSSNAAKGDNHAPKQRSRSMSASHYET
RREKANKVDVLSKEEISKVLSNDCLFSNGTDNMEDFELDASILNVGMVVGYLGSIELPST
SSNLEYDSLQAIRGCMRRLRAEQKIHSLVLMKIMHDSIQLCTDKNGAIAVYPAEKLAFSA
VCPDDRRFFGLVTMQSPDDQSLAEEEGVLRTSCHVFMVDPELFHHKIHQGISRRFGFECT
PDPDTNGCLEFPTSSLPVLQFISVLYRDMGELIEGMRARAFLDNDADAHQNNSTSSNSDS
GIGNFNQEEKPNRVLVVDLGSAPSKHNPHALREAAGGRAQSHQAALHWNGYPNEEEGHFS
LQGAHADKQQNFKKHLGPSARIEVPVVPTRGPVPPSKKATTLDGGGQRWLPVHVIRDWQH
GNISDQESYADSTDGWSSINCGTLPPPMSKIPADRYRVEGNFGQPQPVTRKVESWTKKVF
DVHNKFGASHNSARAREDRKSSKPSHLVQAPQRSSGRRSFGRSKRFSITRSLDDLEAATV
SDGELNSTDLKGCISENSLSSNASLPSVQSCRRLGERRVASWAVSFERLLQDPVGVRYFT
EFLKKEFSEENILFWQSCEYFSRIPIHDKNELSYRAREIFNKFLSSKATTPVNIDSQAHL
ADDVLNAPHPDMFKEQQLQIFNLMKFDSYTRFLKSHLYQECMLAEVEGRSLPDPQEVPSS
PTSKHSISSERSNISTPKKLSKKNRSGRSLNEESGGEDDNERKKKGAFFSWSRSKSIGKS
QKKRENGEISAADCSHINGGNSRRRGSQGSVSSSASLELINCGTNGNALEEKEKVSKQCY
ISLPDGSSCAMVVKSGLSIKDMLSGLCDKHGFNIAAVDLFLIGGNKPLVLSQDSSILESR
DLRIEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLNLTELVARLSGEHEPL
DLGLPISNLDGQRVVLEEKENLRGKEKQKAPVLKPSPTVISGPRSPSSAGEDRPLVKSAS
IRLKRENGKGSRDARLLNKDEPVVRPGRRRQQKINLDEAEAFFEMISKAQSNRAEDQRGL
LRKEDLVLPDFLRLTPSESVSSTPAGSNSNNKRPGRRDSGDRAAPSSRAMNGTRQETPPK
CTDRPLKSGGLDRRDKPDFLQAGSRKPYVPFNAPLSPIPHVQERNKPGKERHSRDLPLDN
IQTIEDENVADLTLVAEGDISSPNSTLLPPPPSSQDNSGYQRSGISRF
Download sequence
Identical sequences F6UAR3
ENSXETP00000012080 ENSXETP00000012080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]