SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6UFD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6UFD1
Domain Number 1 Region: 18-310
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.76e-88
Family Amylase, catalytic domain 0.000000000346
Further Details:      
 
Domain Number 2 Region: 311-404
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 5.4e-27
Family alpha-Amylases, C-terminal beta-sheet domain 0.0000407
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6UFD1
Sequence length 413
Comment (tr|F6UFD1|F6UFD1_MONDO) Alpha-N-acetylgalactosaminidase {ECO:0000313|Ensembl:ENSMODP00000008741} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=NAGA OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
AMKLLVALLALVAPGFSLENGLMRTPPMGWLAWERYRCSINCHEDPDNCINERLFMAMAD
RLAEDGWRELGYVYVNIDDCWMALQRDEGGVLVPDPERFPSGIRALADYVHSRGLKLGIY
GDMGSMTCMGYPGTTLATVALDAQTFASWGVDMLKLDGCYSSSLERALGYPAMAKALNNT
GRPIGYSCSWPAYDGGLPPEVNYTLLADICNLWRNFDDIEDSWQSVLSIVDWFSEHQDVL
QPMAGPGHWNDPDMLLIGNYGLSFEQAKAQMALWTVLAAPLFMSTDLRAISPQNVDILQN
KLMIRINQDPLGIQGRRVLKTKHHIEVFVRPLSKDASAVVFFSRRTDMPYRYRTSLGALN
FTGHALYEAQDVYTENVISGLTRDTDFTVVINPSGVVMWHVYPIVGKESLPWL
Download sequence
Identical sequences F6UFD1
ENSMODP00000008741 13616.ENSMODP00000008741 ENSMODP00000008741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]