SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6UJ42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6UJ42
Domain Number 1 Region: 18-277
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-56
Family YWTD domain 0.00000183
Further Details:      
 
Domain Number 2 Region: 629-884
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-54
Family YWTD domain 0.00000478
Further Details:      
 
Domain Number 3 Region: 328-558
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-50
Family YWTD domain 0.00000192
Further Details:      
 
Domain Number 4 Region: 931-1190
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-38
Family YWTD domain 0.0000643
Further Details:      
 
Domain Number 5 Region: 1321-1356
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 887-934
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000239
Family EGF-type module 0.023
Further Details:      
 
Domain Number 7 Region: 1242-1282
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 8 Region: 1283-1319
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 9 Region: 585-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000737
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 10 Region: 282-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000766
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1200-1252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  F6UJ42
Domain Number - Region: 1431-1473
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0462
Family Prokaryotic proteases 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6UJ42
Sequence length 1599
Comment (tr|F6UJ42|F6UJ42_XENTR) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=lrp5 OC=Silurana.
Sequence
VLEKNIVLNVFLFSAGSPLLLFANRRDVRLVDAGGTKLESVVVVSGLEDAAAVDFLYSQG
VIYWTDVSEESIKQTLYNQSSNLQTVVISGLVSPDGLACDWIGKKLYWTDSETNRIEVGN
LNGTYRKVLFWQDLDQPRAIALDPAHGYMYWTDWGDTPRIERAGMDGSMRKVIVDTDIYW
PNGLTIDLDEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLAGDTLYWTDWQ
TRSIHACNKRTGEKRREILSSLYSPMDIQVFSKERQPYFPTPCDESNGGCSHLCLLSPRE
PFYSCTCPTGVQLTQDGKTCKTGADDVLLLARRTDLRRISLDMPDFTDIVLQIDDIRHAI
AIDYDPVEGYIYWTDDEVKAIRRAYLDGSGAQTLVTTEVQHPDGIAVDWVARNLYWTDTG
TDRIEVTRLNGTSRKILISENLDEPRAIVLHPLTGYMYWTDWGENPKIESAYLDGSERMV
LVNSSLGWPNGLALDLQDGKLYWGDAKTDKIEVINVDGSNRKTLLEDKLPHIFGFTLLGD
YIYWTDWQRRSIERVHKVRASREIIIDQLPDLMGLKAASVSNTFGTNPCADNNGGCSHLC
FFSPRGVRCSCPIGLELLSDMRTCIIPEAFLVFTSRATIHRISLETNNNDVAIPLTGVKE
ASALDFDVSDNRLYWTDITLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWSD
TGTNRIEVSRLDGLYRQVLVWKDLDNPRSLALDPAKGYMYWTEWGGKPRIVRAYMDGTNS
IILVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGAERVIIADDLPHPFGLTQYSD
YIYWTDWNLHSIERADKLNGNNRTLIQDHLDFVMDILVFHSSRQDGLNDCMQNNGHCSQL
CLAVPKGYKCSCSSHYTLDSNNRNCSPPSNFLLFSQKTAINRMLLDEQQSPDITLPIHGL
RNVKAVSYDPLDKLIYWVDGRQNIIKRAKDDGTQPFVVVSTPNQSQTPEKQPHDLSIDIY
SHTLYWTCEGTNTINANKLNGESIGVVLRGDHDKPRAIAVNAERGYLYFTNMQERSPKIE
RAAFDGTEREVLFSTGLIRPVALVVDNKLGKLFWVDADLKRIESSDLSGANRVTLEDSNI
LQPMGLTILGDHLYWIDKQQQMIERVEKTNGIRRTKIQGRIAHPTGIHAVESVDMNEFSA
HPCSRNNGGCSHICITKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPEQFTCATGDIDCI
PMAWRCDGFSECDDNSDEENCPVCSSNQFQCEKGQCIDARQKCNGEIDCQDKSDELDCDS
ICLPDQFRCANGQCIMMSQQCDTFPDCSDSSDELICDKPPSEKTPSHSSAIGPVIGIILS
VFVMGGLYFVCQRVVCHRYTGPNGPFPHEYISGTPHVPLNFITTRSSQPNTYTGISYGKP
MIGSMSIMGGSSGAPLYDRNHVTGASSSSSSSTKATLYPQILNPPPSPATDRSLYNTEVF
YSSNSPSTTRSYRPYLIRGIAPPTTPCSTDVCDSDYTTSRWKANKYYMDLNSDSDPYPPP
PTPRSQYMSAEESCPPSPTTERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences F6UJ42
ENSXETP00000022100 ENSXETP00000022100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]