SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6UMW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6UMW3
Domain Number 1 Region: 924-981
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 756-813
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.8e-26
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 420-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.23e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 140-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.35e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 364-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.36e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 868-925
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.12e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 308-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 8 Region: 196-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.05e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 9 Region: 476-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.15e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 10 Region: 644-701
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.55e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 11 Region: 588-645
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.16e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 12 Region: 700-757
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.51e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 13 Region: 812-869
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.84e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 14 Region: 252-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.2e-22
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 15 Region: 532-589
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.82e-21
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 16 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-20
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 17 Region: 90-141
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-19
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 18 Region: 966-1018
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.09e-19
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6UMW3
Sequence length 1021
Comment (tr|F6UMW3|F6UMW3_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000005736} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
LQEVVTFKDVAVDFTREEWCLLSPPQKGLYKEVMLENTRNLLSVGLLALPEKVISYLEQM
DRFSLARRRMTISYDPESREEKKAAELDESLSEHRKIHTAKKPYECKQCGKAFSRNAHLV
VHQRTHTGEKPYECVQCGKAYSRNSQLAAHQRTHTGEKPYECVQCGKAFSMSSYLAIHQK
IHTGEKPYECKQCGKAFTQSSTLYQHHRIHTGETPYKCKQCGKAFIWKSYLSVHQRIHTG
ETPYQCKQCGKTFNWKSCLTVHERIHTGEKSIECKVCGQTFAMRSYLVVHRRVHTGEKPF
KCNQCGKAFSMSSSLGKHQRIHTGEKPYECKQCGKAFSVSSSLVVHKRMHTGEKPYECVH
CGKAFRINSSLVKHLRTHTGEKPYECKQCGKAFSMSSSLVKHQRTHTGEKPYKCQQCGRA
FSISSSLVLHQRIHTGEKPYECKECGKTFSRSSSVFLHRRIHTGEKPYECKQCGKAFSVS
SSLVLHQRIHTGEKPYECMECGKTFIVSSNLAVHQKIHTREKYYECKQCGKTFMYRASLS
GQQNFHTGIFPYECKQCGKPFSQNSNLVVHQRIHTGEKPYKCKQCGKAFSVSSTLVKHQR
IHTGEKPYKCKHCGKAFSVLFTLVNHQRIHSGEKLYHCKQCGKTFSQSSSLVVHQRIHTG
EKPHGCLECGKTFSRISLLTRHQIIHTGEKLYECKQCGKTFFHTSSLSRHQIIHTGEKLY
ECKQCGKTFFHTSSLSRHQRIHTGEKPYECKHCGKTFSQSSSLVEHQRIHTGEKPYECKH
CGKAFSQNSRLAVHQRIHTGEKPYECKHCGKAFSQNSRLAVHQRIHTGEKPYECKKCGET
FSQNSNLVLHQRIHTGKKLPECKQCGKTFSQNSNLVLHQRIHTGEKPYKCKQCGKAFSVN
FTLVNHQRIHTGEKPYECKQCRKTFSTNSHLAEHQRIHTGEKPYECKQCGKRFTQNSSLV
VHQRIHTGEKPYECKQCGKRFTQNSSLVVHQRIHTVKVPYECKSCGKTFIRSSQLVLHHK
I
Download sequence
Identical sequences F6UMW3
13616.ENSMODP00000005736 ENSMODP00000005736 ENSMODP00000005736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]