SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6URH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6URH3
Domain Number 1 Region: 385-645
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.85e-75
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 263-374
Classification Level Classification E-value
Superfamily Kringle-like 5.8e-33
Family Kringle modules 0.00029
Further Details:      
 
Domain Number 3 Region: 99-148
Classification Level Classification E-value
Superfamily Kringle-like 3.01e-17
Family Fibronectin type II module 0.002
Further Details:      
 
Domain Number 4 Region: 160-199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000055
Family EGF-type module 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6URH3
Sequence length 654
Comment (tr|F6URH3|F6URH3_CALJA) HGF activator {ECO:0000313|Ensembl:ENSCJAP00000025782} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=HGFAC OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MGCWAWVPSPCPPLGLGPFLLLLLLLLPRGFQLHPGGNYTDSPEPNATVTPEIPTILVTS
VTPEIPATSAPEAEGPQGGVLLPWHRAVPLSSSPQAQALTEDGRPCSFPFRYGGRMLHAC
TSEGSAHRKWCATTHNYDRDRTWGYCVEATPSPGGPAGPEPCASSPCLNGGSCSNTQDSR
SHHCSCPPAFTGKDCGTEKCFDETRYEYLEQGDRWARVHQGRVEGCVCLEGRAWCEGTRH
TACLSSPCLNGGTCHLVVATGTTVCACPRGYAGRLCNIVPGERCFLGNGTGYRGVANTSA
SGLSCLAWNSDLLYQELHVDSVGTAALLGLGPHAYCRNPDGDERPWCYVVKDSALSWEYC
RLASCESFTRAQPPLPDLLVTLPEPASARRQACGKRHRKRTFLRPRIIGGSSSLPGSHPW
LAAIYIGDSFCAGSLVHTCWVVSAAHCFSLSPPRDSVSVVLGQHFFNRTTDVTQTFGIEK
YIPYTLYSVFNPSEHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWG
HLGEDVSSYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGP
LACEKNGVAYLYGIISWGDGCGRLHKPGVYTRVANYVDWINDRIRPPRRPSAPS
Download sequence
Identical sequences F6URH3
ENSCJAP00000025782 XP_002746077.1.60252 ENSCJAP00000025782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]