SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6UV73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6UV73
Domain Number 1 Region: 204-449
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.82e-87
Family Eukaryotic proteases 0.0000958
Further Details:      
 
Domain Number 2 Region: 108-211
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-18
Family Hepsin, N-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6UV73
Sequence length 456
Comment (tr|F6UV73|F6UV73_HORSE) Transmembrane protease, serine 5 {ECO:0000313|Ensembl:ENSECAP00000020697} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=TMPRSS5 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MEAQYAEEGPGPGIFRSVLGDPLWRPEAQQQPISPSRRWCSRRRGCAVLGALGLLAGASV
GSWLLVLYLWPAASQPVPRNSQDEEMTLNCSEASGGEEALLPSIPKAVSFRINKEDFLLQ
VQVRARPDWLLVCHEGWSSALGVRICRSLGHLRLTHHKGVNLSDLKLNSSQEFAQLPPRL
GGLLEEVWQPRDNCTSGQIVSLKCSECGARPLASRIVGGQAVAPGRWPWHASVALGSRHT
CGGSVLAPHWVVTAAHCMHFRLSRLSSWRVRVGLVSHSMVRTHQGAVVERIIPHPLYSAQ
NHDYDVALLRLRTPLDFSDTVGAVCLPAEEQDFPRGSQCWVSGWGHTDPSHAHSSDTLQD
MVVPLLSTQLCNSSCVYSGALTPRMLCAGYLDGRADACQGDSGGPLVCQDGGTWRLVGVV
SWGHGCAEPNHPGVYAKVAELLDWIQDTAQDSLSEA
Download sequence
Identical sequences F6UV73
ENSECAP00000020697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]