SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6UXG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6UXG2
Domain Number 1 Region: 412-469
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 244-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.21e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 468-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.76e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 300-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 580-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.21e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 6 Region: 524-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.56e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 357-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-22
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 8 Region: 622-674
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 9 Region: 1-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-19
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 10 Region: 191-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.09e-18
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6UXG2
Sequence length 683
Comment (tr|F6UXG2|F6UXG2_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000027893} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
VTFRDVAVDFTREEWRLLSPPQKELYKVVMLENARNLFSVGLPAPPEDVLSSLEQREAPW
MLEQEGPRSSCPGKGGEESQACICLLGERPEYKDPGKAYPKSKIYYEEPLRSHGMLFVIQ
IVFYGGKEIVIYVCMSLYMFYCLFLLEGEIRSQMKSNPTDMSLPVEKIDQHRFMSDGPDN
FTFREFCVASRNSSHIEHQRMHTEEKSSESNHCGKTFMRRASLAGHQRVHTGEKPYECKQ
CGKTFTDNSNLAKHQRIHTGEKPYECKYCGKTFCRSSSLAVHERVHTGEKPYECKQCGKT
FRHSSSLAVHQRIHTGEKPYECKQCGNTFICSSSLAVHERVHTGEKPYQCKECGKIFKQC
STLAVHQRMHTGDRPYKCKQCGKTFSQSSYLAVHRKIHSGQKPYKCKHCGKTFSLSSYLA
VHERVHTGEKPYECKQCGKTFSRSSSLAPHERVHTGEKPYKCKECGKTFSQSSYLAVHQR
IHTGEKPYECKQCGNTFSCSSSLAVHERVHTGERPYECKQCGKTFCQSSELAVHHRIHTG
EKPYECKQCGKTFRLSSQLSVHERVHTGEKPYECKQCGKTFRLNSDLVVHNRIHTGEKPY
ECRQCGKIFSQRSTLAVHHRIHTGEKPYECKQCGKTFSRSSSLGRHERIHTGEKPYQCMH
CGKTFSRNSNLAVHQRIHTGEEP
Download sequence
Identical sequences F6UXG2
ENSMODP00000027893 ENSMODP00000027893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]