SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6UYP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6UYP3
Domain Number 1 Region: 462-673
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-31
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 2 Region: 910-1113
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.7e-26
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 3 Region: 688-889
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.38e-23
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 4 Region: 224-266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000011
Family EGF-type module 0.005
Further Details:      
 
Domain Number 5 Region: 136-267
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000298
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 6 Region: 1297-1338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000458
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 7 Region: 303-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000185
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 1140-1187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000207
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 9 Region: 1201-1334
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000251
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 10 Region: 262-301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000274
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 11 Region: 73-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000196
Family EGF-type module 0.014
Further Details:      
 
Domain Number 12 Region: 397-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000838
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 13 Region: 339-401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000117
Family EGF-type module 0.012
Further Details:      
 
Domain Number 14 Region: 891-939
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000319
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  F6UYP3
Domain Number - Region: 32-59
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00468
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6UYP3
Sequence length 1406
Comment (tr|F6UYP3|F6UYP3_MONDO) Crumbs 1, cell polarity complex component {ECO:0000313|Ensembl:ENSMODP00000015882} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=CRB1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MALSRINSLLIFCLNLLLLLHVKKSFCIGNDTECFSNPCPNNSTCDDAGKDSTCHCSGTT
ENVGEDCIKKLVSCSSKPCKRNGFCFDLDEEPGFLCRCPPGYGGKHCEITFTSCVSGFCR
HGGICHEGTSGPFCDCPDGFIGKHCETDFNECASNPCRNGAVCQDGINGYSCFCVPGFQG
RYCDREVDECVSNPCYNGAKCHNKVGSYICDCLPEYFGTNCEFEIDQCLSQPCLNGGTCQ
DSVGRYFCDCASGFRGEHCEINTNECLSQPCLNQGKCTDGYNSYSCNCDDTGFTGTHCEI
SLSVCSSKPCHNNGTCEEFDDTFICHCWPGFTGSQCEIDINECSSNPCLSTGECVERSWA
SHYGKIPELPSEFNYLQATGYVCHCQPGYTGSRCEDDIDECSSNPCRNGGMCENIPGNYT
CHCPPKDYQGIVYGGVDCREIFLGCTQDKCQNNGICIPYVQNGQHEFSCLCPSGYSGSLC
DIMTTLSFEGNSFLWITSTPGPIKDSLSNIALSFQTVQPSALLLLRGDKDTHVKLELWNG
YVSLSIQANNQSKVLLHISHNVSDGEWHSVEVTLAEAVTLTLRDDSCVEKCVNKTPSPIE
RDQVMIAFQNTFLGGLPVGKTNDGATLLNIYNMHSAPSFVGCLQDIEIDLNLITSENISS
GSSFNVKAGCDRKYWCENHPCQNRGRCVNLWLSYQCDCYRPYEGLNCLREYTPGRFGQDD
STGYALFRLDNNPEEIVTLSMFVRTRRSFGFLLALRNSTFQYLSVWLEHGRLAVLAPSSP
KLLGRSLLNDGNIHLISLKIIPNKIELYQSSQNLGSLSTSTWKIQTGDILYIGGLPDKKG
TEVWGGYFKGCIQDIRLNSQKLEFFPITKGNSTLNQTLVNVTPGCTGDNLCKYNPCHNGG
VCYSIWDDFTCSCPPNTAGKACEEVKWCELSPCPPEFQCQLVSKGFECIASAVFSGRESA
IFFRSNGKITRELTNITFGFRTRDSDVILLYAEKEPEFITISIQNSRLIFQLQSGNSFYM
LSLKSMQPVSDGMWHQVFLSMIEPLAQSSRWRMEVDDQTTIVTSAVATGNLNFLREETNI
YLGDKPFDNLDGLRGCLSSIEIGGIYLSYFENADGHTKKPQDEQFLKISTNSVVTGCLQV
DACNSDPCWHDGDCEDFYNSYGCVCPIGWTGAHCEINIDECFSKPCVYGNCSDRIAGYTC
KCNPGYTGVNCETNIDDCENHRCANGATCIDGINGYSCLCFGNYTGKLCRQTRLPMTVCG
NERRNLTCYNHSNCTELQGDLKCVCRPGFTGEWCEKDINECDSDPCLNGGLCQNLLNTFQ
CNCDGNFAGERCELDLTDNLISDIFTAIGSITLAVLLILFLAVVASFIASNKRANQGTYS
PSRQEKEGSRVEMWNMVQPPPMERLI
Download sequence
Identical sequences F6UYP3
ENSMODP00000015882 XP_007481075.1.35504 ENSMODP00000015882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]